SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb022300 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb022300
Domain Number 1 Region: 189-386
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.72e-38
Family Nuclear receptor ligand-binding domain 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bmb022300
Sequence length 475
Sequence
MLAKSGIHHTSSLKDRDSDKIVNNSQYNPSIWPLSRGGQKSYEVFAPRGHEGYGGFDGLQ
MLRADRGYKFRVLTHQTTPLILSHPMSDLRPGLEPAVQHERGPRKPKLHAGALSSLPPPS
MTHAHKPQVLKLSPPSPYAPLSLPQPLNFQFSLSGMNEPAPLSAASSAGSSAAGTGACSP
LPLVPDSFLPPPPPGLLHILMSTDKCHELMWSAKQLQLQGDPTLLRPPPSAFGAPLAPTW
ELLQETSARLLFMAVRWVRCLAPFQALSPSDQLVLLRAAWKDLFLLHLAQWSAPWDLAPL
LSAPAARARLPPDPLADLELNTLQEILCRFRQIAPDGSECGCMKAIVLFSPDTAGLSETQ
PVEMLQDQAQCILADYVRTRYTRQPTSSKEASQLVDRVQRRHYPTSVMVWWGISYEGVTE
PYFCEKGIKTSAQVYQNTILEKVVKPLNNTMFNNQEWSFQQDSATWALSDFSDGL
Download sequence
Identical sequences Bmb022300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]