SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb024397 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb024397
Domain Number 1 Region: 125-256
Classification Level Classification E-value
Superfamily L domain-like 2.83e-32
Family Ngr ectodomain-like 0.0000802
Further Details:      
 
Domain Number 2 Region: 294-421
Classification Level Classification E-value
Superfamily L domain-like 5.67e-31
Family Ngr ectodomain-like 0.0026
Further Details:      
 
Domain Number 3 Region: 2-57
Classification Level Classification E-value
Superfamily L domain-like 0.0000000000218
Family Ngr ectodomain-like 0.0022
Further Details:      
 
Domain Number 4 Region: 449-486
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000153
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bmb024397
Sequence length 500
Sequence
SLYDNNIRSLPNGTFDALTGIQTLHLGRNPFVCDCSLRWLAAYLRKNPIETSGAKCDSPK
RMNKKRIDALREENFKCKPGEGAGEAAACGGAAWCPAACTCEAAALRSLSVRCERAGLRD
LPRDLPLNTRLLMMSDNNLGQIKSDGLFGRLPDLTKLDFRNNGISVIEDNAFDGAANIQE
MLLDGNLLQTVTDKMFFGLHSLNVLSLTHNKIKCITPGAFDHLTTLSTLELSSNPLSCTC
HMSWLAQWLRSRRLSTTATCGYPAALRDASIHHLEPADFKCTPEDKGCLSPEYCPAQCSC
TGTVVRCSRAKLTSLPANIPKQTTELYLESNELTSIPPDQIRHLTQLTRLDLSNNKISVL
GNNTFEGLTKLSTLIVSYNRLRCVQRDALKGLSQLRVLSLHGNNISLLADGVFRDLESIS
HVIEKARNPVPLLTGEFCETKIPFCTAEFNPCANGAACTDHRSHYTCSCPKGYSGQNCTV
NADDCINHMCQVGPPPPPKA
Download sequence
Identical sequences Bmb024397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]