SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb025761 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb025761
Domain Number 1 Region: 377-596
Classification Level Classification E-value
Superfamily GFP-like 2.2e-54
Family Domain G2 of nidogen-1 0.000081
Further Details:      
 
Domain Number 2 Region: 646-683
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000454
Family EGF-type module 0.061
Further Details:      
 
Domain Number 3 Region: 336-374,601-690
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000108
Family Growth factor receptor domain 0.014
Further Details:      
 
Weak hits

Sequence:  Bmb025761
Domain Number - Region: 689-717
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0205
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bmb025761
Sequence length 718
Sequence
MSMYFGKQSTPGIQVGNIEASIQAGNIQGSGHILPSKYRPRIHMLPEKHACLQLVSYLRF
LLQFWSESRVMWTCAGLLALATCAVAITRDQFYPYGPELDQRLPRGSEVPSPEVTLNVPI
VFYDETYETVFVNNHGVLTFRADLPQFINTEFPLPYPAIAAFYSNVDTTDEGAIYYRETN
ESHILSKAEESVQNNFHDYYDFRPTSVFITTWLDVTYTSTLHDRKNSYQVAVISNGTESF
VELLYPEREIQWIQKETDALSLPDAKAQAGFVAEDGRVFTLRGSGSHQIRNIISWTNTHE
PGKYVFRVGTIPRDSNIAVPDEYNETEIEIAEESKTCAQSGPSVCHMQARCVDYQAGICC
QCSEGFYGNGKSCIKNDVPLRVHGKLNGVLNDVHLNDVDIQSYVVVADGRAYTALSLTPP
VLGSSLQLLNIMGSVVGWLFAKPSSTAKNGYQLTGSLFNHSVDIWFPKTGDRVTVNQEYL
GHDVFDQITLDADVRGSVPVILSGIKLDIGDFEEQYTIVEPGLIRSDSSRTFTNKITGET
YEQRVSQTITYRACRYAPPSADDTIPSTLKVTKNYLGYETKNNIVRYGTSNKIVPLGQED
PCIEGRNTCGSYSTCVVQGDSFSCVCNKGFNKIYVDDVLTCVDIDECAAGTHNCDPNADC
NNGEGDFQCRCKTGFIGNGIECSPLSISRCQSLSCDVNADCLENNGEEPICVCRPGYT
Download sequence
Identical sequences Bmb025761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]