SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb025915 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb025915
Domain Number 1 Region: 550-660
Classification Level Classification E-value
Superfamily DNase I-like 1.17e-31
Family DNase I-like 0.0011
Further Details:      
 
Domain Number 2 Region: 107-145
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000134
Family EGF-type module 0.013
Further Details:      
 
Domain Number 3 Region: 890-1056
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.0000178
Family RNA-dependent RNA-polymerase 0.04
Further Details:      
 
Domain Number 4 Region: 73-107
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000932
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bmb025915
Sequence length 1137
Sequence
MFQRKCNCNQYCITGKTARTVERGACGKMAEGDWWQRHLCAQEGSWRCLCAAGWGGGACD
SLLPLAPAAPPPCPCQAGGTCLPSALPPGWACGCREGRTGALCELSLDLCGSSPCRNGGR
CVGGSGWWMCECVAGWTGETCAVRVSAPPLLCSPPCPAPAACVADPARPSSTRCLCPAPP
QRAARRCLETVAGLEAEGDDVDVLQNDNHGVYNRPDPNVGDGPGACGVANGTWWCVVPGG
TPATRASPCITCAPASGAELPGGSFWDDVVLSPPTPSPAPHPAVLAQGAQLTPAPHQPIC
AQCSACSSARERLGPGAHVERACGALRRALAAALAVQDPPPPPLALLCDLAPDDDDALDL
ALWIGDEVGSDGASGAAALGTAVRALGELVSRRRLARHALLGAVLRLRMPPIAPPASEPS
TAPATTIAVGLPVVLLVVAAAIGAFLFVRRRRVAAAERSRRCDEEKSNNLQNEENLRRYA
NPLREERGGTRGEDLPRAHSLYKAQNADARNDTPPRDKELTLRALPPPEPPPPARHPPPE
RLTVLVPTVEFGHFLRGIGAIARRLAPRPVILAGDLNAKSIAWGSPRSDTRGRLLERWAN
AAGLCLLNRGSVATCVRWQGESIVDVTFASPAIARRIHDWRVLEGAETLSDHRYIRFDLS
ARSAVADALGDHPRGASRSFPKWALKRLNKELLMEASTVAAWAPMRPHPVEIEGEAGWFR
DTMRHICDVSMPRIGPRLPNRQAYWWSPEIAQLRVECVRARRECARHRRRSLPRRNDPVA
FAAAEARLHAAFRVTQRALQLAIRRAKDQHMEGLLETLDEDPWGRPYHMVRNKMHPWPPP
DHGASPASAAAGHRLGAVPAGAGGICRSRYGVPAEVPHITGAELRVAVRKMCAKDTAPGP
DGVHGRVWALALGALGDRLLRLYNSCLESGRFPSSWRTGRLVLLRKEGRPADTAAGYRPI
VLLDEVGKLLERILAARIIQHLVRVGPDLSAEQYGFREGRSTVDAILRVRALSDEAVSGG
GVALAVSLNIANAFNTLPWSVIGGALERHGVPPYLRRLYNDQFIARLLWRQRLLWSCDTS
IPIQTKIRSYTSIKYWIEHHNIDLCVYKYVFNILLRNLTFRNLKKNVQMMLEAQVML
Download sequence
Identical sequences Bmb025915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]