SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb028338 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb028338
Domain Number 1 Region: 10-139
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.08e-31
Family Laminin G-like module 0.0016
Further Details:      
 
Domain Number 2 Region: 167-314
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.64e-22
Family Laminin G-like module 0.0084
Further Details:      
 
Domain Number 3 Region: 342-369
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000541
Family EGF-type module 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bmb028338
Sequence length 563
Sequence
MDLLRDPISASREVIRFRLKTSTASGALLYSRGTQGDYLALQLRDNRLVLNIDLGSGMST
SLSVGSLLDDNIWHDVVISRNRRDIIFSVDRVIVQERIKGEFSRLNLNRALYIGGVPNLQ
EGLVVNQNFTGCIENMYLNATNVIQDLKKGYESGEPFKFQKLNTLYACPEPPVVPVTFLK
EGSYAKLRGYSGGSALNVSLEFRTYELQGLLVYHRFNTEGYVKVYLEDGKVKVELETAGS
PRVKLDNYVELWNDGRWHSLMLTLAPDSLVLSMDSRAVHTSKRLRFLTGSYYFIAGGKAP
PRGFIGCMRKISVDGNYRLPTDWKKEDYCCPNELVFDACQMIDRCSPNPCEHGGRCAQTA
DEFSCNCRDTGYAGAAYHSVSAARRSASVHIDVDGSGPLPPFPVTCEFYCEYAPSPPNPP
PPPRPPPAVTAPSLAADGRVITSVKHSVSQSTVVDGYQEAGSFRQDVIYDANRAQLEALL
NRSVSCSQRLDYWCRHSRLMNSPSEESNFQPFAWWVSRSGQRMDYWAGATPGSRMCACGL
LGSCLDNTKWCNCDAEYAQLRPE
Download sequence
Identical sequences Bmb028338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]