SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb030195 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb030195
Domain Number 1 Region: 23-235
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-23
Family YWTD domain 0.00048
Further Details:      
 
Domain Number 2 Region: 361-401
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000021
Family EGF-type module 0.022
Further Details:      
 
Domain Number 3 Region: 326-358
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000678
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bmb030195
Sequence length 436
Sequence
FVVSTKDQLDFYVNNTKTTEHMNGRQPTVLDYDSVNDNILFVDVYSNSTYSYHLPTKQST
KLVNSNILTFDLAFDPAKRILFWSEPQVKSIYWTSVKPGSKSTNGNLLFKMENEIPEALA
VDSCRGYIYWTNTNLSSPSIGRAKFDGTDRKTIVSNIRYTPVAITLDQQTKKIYWINSEG
INYSIESSDLDGANRNILLTASTHHDPIAISVSKDYIYWISKATHSIWTLPKNSDTLTDR
GNELIKSSNEIIDIFAHYKIEDQIRNIEECQHLSNLTESKRVQETTTALPAIDYTEFCEH
DATNENRFSCKCPEGIYRERCEAFVCMNYCFNGDCTLNKDGQPQCGCKEGYSGRRCEINI
CRGYCLNSGACTVDDKLKPICKCQLGHEGSRCETDVRATTTSKNIESTTSTVTEIAKTYN
TSDLPRIPSTSSDNCK
Download sequence
Identical sequences Bmb030195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]