SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb030580 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb030580
Domain Number 1 Region: 57-93
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000864
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 2 Region: 94-143
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000583
Family EGF-type module 0.017
Further Details:      
 
Domain Number 3 Region: 175-203
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000016
Family EGF-type module 0.035
Further Details:      
 
Weak hits

Sequence:  Bmb030580
Domain Number - Region: 7-41
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000353
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number - Region: 171-249
Classification Level Classification E-value
Superfamily L,D-transpeptidase catalytic domain-like 0.0863
Family L,D-transpeptidase catalytic domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bmb030580
Sequence length 261
Sequence
MSGSVYCAGRCIPKELVCDGRNNCEDSGGSGAGTDEDPLICSSFASATGSTSHESAGECE
RGEWQCGDGGCAPRDALCDGTRDCEDYTDEFPCDINECATLNGGCSHNCTELPVGRACWC
RAGWRGSGTACADVDECYEDQPCEQHCRYVPPDEARRREPARGRQECTVTVLCGRNTLGS
FVCSCAAGYRLADDGVSCSPVSSIKASLVFTNRYYIRRASLHAGASSLLVHNLTNAVALD
AHWSSGCLYWSDVTLLGSSIK
Download sequence
Identical sequences Bmb030580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]