SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb035071 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb035071
Domain Number 1 Region: 58-174
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.27e-22
Family Spermadhesin, CUB domain 0.00094
Further Details:      
 
Weak hits

Sequence:  Bmb035071
Domain Number - Region: 4-42
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0131
Family Spermadhesin, CUB domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bmb035071
Sequence length 223
Sequence
MASFCNDTPKPIMSNGPKLSIEFRGIFSSRNSRGFKISYYFVEDYAISTGIQLQEFPCAF
VYNSSERSKGVVTSPNYPGFYPRDTECNYFFYGHENERVLLHFTYFDVEGVMPCEAVSAS
DYVQFSSQMIDSKSQRYCGQLRELQVTSDKNFLRITFRSNDRLDGTGFKCDYIFLRDSEM
HSMTMPDSHDKGIGLRLELVESYRQRLFKYIMFEDLLLVQIFG
Download sequence
Identical sequences Bmb035071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]