SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb036400 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb036400
Domain Number 1 Region: 255-469
Classification Level Classification E-value
Superfamily YWTD domain 3.79e-23
Family YWTD domain 0.0004
Further Details:      
 
Domain Number 2 Region: 158-205
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000142
Family EGF-type module 0.008
Further Details:      
 
Domain Number 3 Region: 521-643
Classification Level Classification E-value
Superfamily YWTD domain 0.000000209
Family YWTD domain 0.0035
Further Details:      
 
Domain Number 4 Region: 77-118
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000034
Family LDL receptor-like module 0.0028
Further Details:      
 
Weak hits

Sequence:  Bmb036400
Domain Number - Region: 131-168
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00263
Family EGF-type module 0.049
Further Details:      
 
Domain Number - Region: 473-514
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0324
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bmb036400
Sequence length 668
Sequence
MDFSNARGRAKPLPTDYWLMIINILVTNYVSGGAAIVRSFVSSVLRALRTRVPAGGQGLL
PPLNQACVLLVPGEKDFKCRGNWARCATPVGGQFSCVPIVQFCDGERHCADGSDEWDICD
NFTVSSCAPLRCEVGCRPTHDGLACYCKPGYEQREGKCADTDECLLEESCAQRCANTAGS
YSCSCGPGFVLDQDGFSCLALNGMILQITTEQHVQLDIRDSGSGCKEIVFEQMMIFMNTQ
TKSICFVHHIVSRSSLLCVDADDFSKRTSLPDPDFFPDLDTVNAVAVDWVSGSWYVSDGG
REALYVCARSLAPCRLLLDAALSKLHGLALDPSPPAGYMFWTVWGASPPGVYRALLSGEG
RVAVAALKLVYPSALTLDPAQQHLYWVDTYLECVERTDYDGHNRKTIHRGYVSQRLSHIA
VFEWRLLLPMWGNRSVVAVSRYSRPHPREDTPLDARPTAVLVYHRQIQPKVQHPCGVHNG
GCAHICVSGYRGGAPHARCLCAHGYRRAGHGDCLRVELESNLVVCRGSPPMVQVLAVGAA
GGEGAAPALHGSRPAAADIDLDQGWLYYCDVHKCDTYLNKIERLVLSSGTRQLVARNTLQ
TPVLKPYGLALHEESVIWSEHGTGAIRKLSLGNVTVIHQLPPPLYDLKVVSTEQIHSEPP
PSALSDCP
Download sequence
Identical sequences Bmb036400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]