SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb036661 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb036661
Domain Number 1 Region: 173-282
Classification Level Classification E-value
Superfamily Cadherin-like 2.09e-27
Family Cadherin 0.0015
Further Details:      
 
Domain Number 2 Region: 850-961
Classification Level Classification E-value
Superfamily Cadherin-like 1.37e-26
Family Cadherin 0.0021
Further Details:      
 
Domain Number 3 Region: 549-682
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-25
Family Cadherin 0.0019
Further Details:      
 
Domain Number 4 Region: 955-1066
Classification Level Classification E-value
Superfamily Cadherin-like 4.57e-25
Family Cadherin 0.0012
Further Details:      
 
Domain Number 5 Region: 7-111
Classification Level Classification E-value
Superfamily Cadherin-like 5.28e-23
Family Cadherin 0.0016
Further Details:      
 
Domain Number 6 Region: 660-793
Classification Level Classification E-value
Superfamily Cadherin-like 6.85e-22
Family Cadherin 0.013
Further Details:      
 
Domain Number 7 Region: 278-392
Classification Level Classification E-value
Superfamily Cadherin-like 6.14e-21
Family Cadherin 0.0011
Further Details:      
 
Domain Number 8 Region: 392-495
Classification Level Classification E-value
Superfamily Cadherin-like 1.04e-17
Family Cadherin 0.0023
Further Details:      
 
Domain Number 9 Region: 113-185
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000288
Family Cadherin 0.0025
Further Details:      
 
Domain Number 10 Region: 1358-1395
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000206
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 11 Region: 1397-1434
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000165
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 12 Region: 1318-1358
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000385
Family EGF-type module 0.013
Further Details:      
 
Domain Number 13 Region: 794-834
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000414
Family Cadherin 0.0034
Further Details:      
 
Domain Number 14 Region: 518-561
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000942
Family Cadherin 0.0097
Further Details:      
 
Weak hits

Sequence:  Bmb036661
Domain Number - Region: 1258-1317
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00042
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 1413-1475
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0712
Family Laminin G-like module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bmb036661
Sequence length 1479
Sequence
TIQLKDVNDMAPEFITPNVTSISENIPLNTVVMTIKAIDKDEGRNGYVEYFMMPNPEING
YFSLGNVDGIIRATGKLDRELKSNYIITVTAKDRGDPPNVTKMDIKISIIDENDNSPVFD
PKQYSASVPENASIGASVLQVSATDVDEDANGRVRYSIASGSPPLTGSGTVKIIVQDVND
NSPEFERQSYKTSVKENLPSETMIFHAKATDKDTGNNAKIRYSVLGDKSERFKIDPNTGM
LYTNETLDREEWDVYYLILMAQDSSTTDPRTATANLTIVVEDENDNTPTFPHPVYETQIS
ERTMKGNFVFGVKATDNDIGLSKKIEYDLEGEHKHLFTINKETGVIKAKENLITYKDKSI
SSFNLVITAKDSGTPPKESSAELILILKSVRNFPKFSVTNKLSFTFSEDTPEGVLVTRLS
ATSPKSGPAGLLQYGIAGGNIGDALRVDQMSGEVFLTGKGLDYETMPLYEVWLEAKDSDN
PPLKSFIEVEIQVTDANDNAPIIENLCTMLQCWKKNPLLSSLDREIQDEYILKVAAIDGA
WRSETALTITIQDQNDNAPEFEYSYYSFNFPEMQFKNSFVGQVIATDRDKQGPNSIISYS
LQQPSDLFSIDPATGEILSKFTMNYKRTSTNSSPENTYSVVVVATDNGKPPMSSECLVII
NVVDANNNAPKFRDHEKLIPIPKEATIGEKIIKMKAEDNMDFGINAEVEYYVSGGNGSSY
LTMDPNSGWIIVNKQLYYLGQYYELKIKATDRGVPPQSDETSIVFVVTGENMYSPKFTAL
SYQVIVPENEPVGVNEYYPKFKQPVFHFDVSESAEVGTNVGVIQATDQDSGIRGNDTDEA
QVIISIQDGNDPPEFVRLNYEATVSEGAYIGHEVIQVQAVDKDVRPQNNQFSFSIIGGNI
EQSFKIDPQNGKIEVARKLDREKLPAYSLIVGAIDTGSPPQTGTATVKIMLTDINDNGPI
FDINSFEGSVYENEPPNTSITTLSATDPDLPPNGAPFTYSIIGGKHESFINVNKHTGVLS
TARKIDREATPILEISIQIEDSGTPVMRSKYDILIKVLDRNDNPPTPRSVHVVVYAFNNK
VPNGKIADVKPNDPDIIGDYKCKIIRDSTSDRTLSLLNIRSGCDLYTNTIKPGQGYSFSV
LGNDGIHKDVISSVSVEYFSFDNTTVEESVTIRVMNMTATFFLTHFYRSLLEILNAKLDK
NKETIFLYGVNEVPNYLDLTVALKGNNSISKKESTEHYLKNKEFEITTLLKHEITIGYYP
CSSHRCPNGGLCTNSIKILEDTKIIDSSAIILSSPFVKHDYECHCAEGFMGKNCEKRQDP
CSPNPCRYGGHCRKQGHDFLCTCPVRRDGKTCELEKNDVCSSSPCKNGGSCKESADGSSF
FCLCRPGYRGNHCEALVDSCRPNPCLYGGICVSLKPGYKCSCSDGRYGTHCESTTFGFDE
LSYMQFPALYASTNGHHDNFCNNETDALLLYNFGAQMPG
Download sequence
Identical sequences Bmb036661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]