SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb037787 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb037787
Domain Number 1 Region: 589-675
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000337
Family I set domains 0.022
Further Details:      
 
Domain Number 2 Region: 681-748
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000852
Family I set domains 0.019
Further Details:      
 
Domain Number 3 Region: 92-132
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000363
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 4 Region: 56-94
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000469
Family Laminin-type module 0.064
Further Details:      
 
Weak hits

Sequence:  Bmb037787
Domain Number - Region: 148-194
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000176
Family Laminin-type module 0.011
Further Details:      
 
Domain Number - Region: 398-434
Classification Level Classification E-value
Superfamily EGF/Laminin 0.001
Family Laminin-type module 0.049
Further Details:      
 
Domain Number - Region: 484-548
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0438
Family I set domains 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bmb037787
Sequence length 748
Sequence
FDGIEIPREHFLVALVDVKAILIKATYSQDSPMAIPISASIDKADPNGEGPAALHVEQCV
CPPAYTGTSCETCAPGYTRGDRTIYLKECIPCNCNGHSNMCNPKTGVCYDCKDNTDGPQC
ELCKPGYDRDGYGNCVESDNFISTQQPCRCNPDGVEVPCDETGTCSCKQNVEGDYCDTCR
PGTYGLDRNNPQGCLSCYCSGVTSECHEGVHYSRIPMAAPVFGENNGGYSLTDLNAEKIY
NEHFVPVPDKSELMYIFSYPPENELYWSLPIFPGNRVLSYGGSLSIRQEFRSNNDDAVSQ
SGVDVVLVGKDASVYWSNPTPIRSGVPLNYQVILSEDNWFLLNTATPVTRNTFMNVLKDL
KRVLVRATLDPNVLSTSIADVSMDTATIMYEQDLPVAKGVEICMCPAGYTGTSCESCSSG
YYKDVSGRCQQCSCNGHDCQLDAYGQTICNCRPPYTGSDCSTIGLVMELHPTISDDGVNS
TVYRKVKFICKYRAPEPLTIKFYHEGREQWPPKYFNESRLHRDGWHGEHVWQTVWDTRKL
GEIYECHTLTEKGFTLGVLTTSLPEPAGEPSVTTPPNQPPPEVTVFVRIIEPSNIRDLHV
GSSVNYTCQAQSRITNRLRIAWSKADGYLPQGRSQVDENSGVLLLTNLQTSDSGQYICQT
SDGYSTAQDVVTLIVPGNDMTPPTVSIRPITTDYYEGDRIELECTATGNPAPSISWQRNS
RRPLPASAESFDDLLIIESARQEDSGEY
Download sequence
Identical sequences Bmb037787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]