SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb039995 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb039995
Domain Number 1 Region: 41-310
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.57e-44
Family Nuclear receptor ligand-binding domain 0.0000228
Further Details:      
 
Domain Number 2 Region: 2-52
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000224
Family Nuclear receptor 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bmb039995
Sequence length 312
Sequence
NIDYTCPAANECEINKRRRKACQACRFRKCLRTGMLREGVRLDRVRGGRQKYRRAPEQAQ
PRVQLDDINVGRRDWDCVCVCVRARARVLEALLSYEPEPFACSAAPPGVTEPAARTLALL
ADLYDRELVEIIGWAKQIPGFTDLQLNDQMRLLQSTWAEMLSLMVAYRSMSSGANLKLRF
ASDLTLDEQEARDIGATDLFLQVSGVVRRLERAGAVREECVLLKALVLANSEARLDEHLT
LRRFREQILQALNEAVAVLRPYGANSALQQLLLVLPALRHADVAVRRFWAAVHRDRRAPM
NKLFVEMLEACL
Download sequence
Identical sequences Bmb039995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]