SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb041378 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb041378
Domain Number 1 Region: 143-181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000307
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 2 Region: 31-89
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000391
Family Laminin-type module 0.0082
Further Details:      
 
Domain Number 3 Region: 92-135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000307
Family Laminin-type module 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bmb041378
Sequence length 374
Sequence
MQLCSDLRVYGAGGVNRPALDIQSPEICKPCDCDPHGTTDEEVLCEVETDEENNKIAGQC
LCKTNVDGTRCDRCKNGFWNFDPYNPYGCEACACNNLGTVTEKGCDPTIGECFCKRHVTG
KSCDQCLPEFYGLTDSEDGCLPCDCDMGGSLDHECDVITGQCKCRPNVIGRRCDQPLQNF
FIGALDSIVYEAESSQCNLQIDDNAIQSQACRVFIRENYPDGKKETWSGPGFMKLPESST
LVFTVNDLQTSMNYNILIRYEPQSPLDWKEANILIKRPYPVDAESPCASKGPENDNIVTY
LPANQRSVLVKPAVCLEKNRENEIRIFMGRQNAQSSNSRATILIDSIVLIPSFDDLPFLT
NGTAMRDEFERYNC
Download sequence
Identical sequences Bmb041378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]