SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb041702 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb041702
Domain Number 1 Region: 152-346
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-32
Family YWTD domain 0.0000252
Further Details:      
 
Domain Number 2 Region: 465-502
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000131
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 3 Region: 506-543
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 4 Region: 549-586
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000681
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 5 Region: 339-377
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000838
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 6 Region: 72-110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000948
Family EGF-type module 0.029
Further Details:      
 
Domain Number 7 Region: 24-58
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000249
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 8 Region: 653-690
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 9 Region: 425-461
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 10 Region: 96-144
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000303
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 11 Region: 375-418
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000055
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 12 Region: 625-645
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000089
Family LDL receptor-like module 0.0053
Further Details:      
 
Weak hits

Sequence:  Bmb041702
Domain Number - Region: 2-20
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000798
Family LDL receptor-like module 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bmb041702
Sequence length 706
Sequence
HFRCDGEDDCGDHSDEVGCVKQNKTCPTGQFKCNNDQCIDYSLVCNKVSDCSDDSDEPAH
CNVDECAKLEINQCGHKCIDTLTSYYCDCNQGYKLLTDGKACADIDECIETPGVCSQYCS
NTPGSYYCKCNDQYYEREADEHTCKRRDKIPPWVIFTNKYYVRNMSTDASLYNLVHQDLM
NVVAIDFDIKEEQMYFADVSAKTIYRSNYTDPNPTKEVVIRHDSHGLEGIAVDWIGRKLY
WLDRHSKNLDVSELDGTRRKTLKTGIADPRAIVVHPGTGYLYFTSWHLQAYIGKMGMDGS
NFTMILNWDDDIAWPNALTIDYFTDRIYWADAHLDYIGTCNPDTEFSCKNGRCIPKLWMC
DFDNDCGDDSDEPAYMCRQKNCTTGWRRCPGQSNYRCIPKWLFCDGKDDCRDGSDELAEN
CPTCAAETDFTCDNKRCIPKQWLCDFTDDCGDGSDETEALCQSKYRECSESEFKCGSGKC
ISSRWRCDHEDDCGDNSDETDCGGFQCKNGTFQCRSGHCIAAHFRCDGDRDCRDLSDEIG
CPPKFPGGRYCPENKFQCGNTLCVSQSDLCDGTDDCGDGSDETPDICNNFNCDTLRRFHC
DNHRCVPSVVNCGLTEQRAAPPLRRYQVCDGVDNCGDGSDENNMTLCASRARPCEPLTQF
QCANKQCVERRRLCDLGDDCGDGSDELGCHHERSCSHLDKGFISQN
Download sequence
Identical sequences Bmb041702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]