SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb042834 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb042834
Domain Number 1 Region: 301-402
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000011
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0033
Further Details:      
 
Domain Number 2 Region: 143-193
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000314
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.068
Further Details:      
 
Domain Number 3 Region: 61-114
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000068
Family HLH, helix-loop-helix DNA-binding domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bmb042834
Sequence length 487
Sequence
MNSSIGTGSNYEKCSKMATREPAEFLPVAVTTNCVYYDSQAASCGDSSSDSRSPETTSAK
ASDRASRIIAEKTRRSQYNALIHQMKSLLSDIAHSQRKVDKTSILRHAVNKLRNEHVFGD
TIKCCHLETWSPAFLKFFDLIGGIMFAVTCRGRIFIVSPNIQEKLGYCHIDLVGQDFYKY
VHEEDRETLRCHIYPPELQTGCDDQLFEHNHNFHIRLMRAGARSDHPRYEKCRISGMLRK
SDRATGNEVQDEHVVRRQRVRNNRTFSSSGNDFVFIGMIRVLSSNLPARILPPTAYSEYW
TRHLIDGRIVQCDQSISLAAGYMTDEVTGTSAFVFMHKEDVRWVICVLRQMYDQSREFGE
SYYRLISRSGHFIYMRTKGYLEIDKKTKKVQSFVCVNTVIGEEFGKRMMEEMKRKYSVIV
GMDKQQQERVLTYDDAPVEHPKCLERIVMHLVEPSVSENVDELKLVPPSRENIISAIKSS
EKVVQET
Download sequence
Identical sequences Bmb042834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]