SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb043111 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb043111
Domain Number 1 Region: 170-206
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000155
Family EGF-type module 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bmb043111
Sequence length 227
Sequence
MLSAYLKIKRERNTRSRTSARPEQSGAAVAVPRDHEQADDHRRGYLDEVQVSVVQAGAAH
GVVLRGLVEAQVHQQLAVGQRGAHLRLLGLPVPATQHGSVQRARADPMGITNTCLFRGYQ
LFRNIEIIVSNGVNVTIVEFFPLRVPGLELPPPFGEVFLPPGGVLRGVVSDDVCASQPCK
HNATCTNTWNDFTCTCPRGYKGKQCGDVEFCQLQGCPPNSHCRDIDQ
Download sequence
Identical sequences Bmb043111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]