SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000034 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000034
Domain Number 1 Region: 253-418
Classification Level Classification E-value
Superfamily vWA-like 9.74e-27
Family Integrin A (or I) domain 0.0089
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000000034
Domain Number - Region: 695-795
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000618
Family Fibronectin type III 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000034   Gene: ENSMODG00000007456   Transcript: ENSMODT00000000035
Sequence length 841
Comment pep:novel chromosome:BROADO5:2:41328377:41379437:-1 gene:ENSMODG00000007456 transcript:ENSMODT00000000035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSEASNYLYGATEKRFYFKGVSILIPETWQKKPEYEKPKLETYKKADIVIDVPNPPNND
APRTDQFGQCGDKGERIHLTPDIILGKKLKEYGPQGKILVHEWAHFRWGVFEEYNEDEPF
YQFNGKNIPVKCSGAITGTNKVNACSGGSCSVRNCRTDPQTGKLNKGCKFIPDEFQTEKA
SIMFMQSINSVVEFCTEKNHNKDAPNAHNQKCNLRSTWEVIKDSEDYKKSNPMTAAQPPK
PTFSLKQIRERILVLVLDKSGSMASGDRLNRLNQASKLFLLQIIEKGSWAGMVTFDSSAT
IQSELIQIETDAQRNSLITRLPTVAGGGTSICSGLRTAFTVIKKKFSTDGSEIVLLTDGE
DNTISTCFDEVKQSGAIIHTVALGPSADPGLEKLAEMTGGMKTTATDNAQNNGLIDAFSA
LSSGNGAITQRSIQLVSKGATVKNGEWMNGTVIVDSTIGNDTLFLVTWTAQQPQIFLSDP
SGKTYNTFSVDANSKMAHLQIPNTAKVGMWRYSLKSNAQTLTLTVTSRAANPTVPPITVD
SKMNKDTSSFPSPMIVYAEVRQGSLPIIGADVTALIESADGTTVTLELLDNGAGADTSKN
DGVYSRYFTAYKINGRYSLKVTALGGTNTQRSSPQVNGAFYIPGWVENGDIKMNPPKPDF
ISDLQGKQVCFSRTSSGGSFVLSNIPSGSIPDVFPPCQITDLKAQMDGNHINLTWTAPGD
DYDNGQAEQYIIKMSENILDLRDKFDDALQVNTSDLIPEKANSQEFFIFEPKDINLVNGT
NIYIAIQAVDKANLKSSISNIAQVSVFIPPEETPCAGNNIFKIVLKWLGELQLTIPKEST
T
Download sequence
Identical sequences F6S0F1
ENSMODP00000000034 ENSMODP00000000034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]