SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000113 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000113
Domain Number 1 Region: 513-799
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.34e-73
Family Protein kinases, catalytic subunit 0.000000883
Further Details:      
 
Domain Number 2 Region: 228-416
Classification Level Classification E-value
Superfamily Fibronectin type III 8.83e-28
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 3 Region: 53-149
Classification Level Classification E-value
Superfamily Immunoglobulin 4.28e-17
Family V set domains (antibody variable domain-like) 0.0000221
Further Details:      
 
Domain Number 4 Region: 144-218
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000904
Family I set domains 0.0000523
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000113   Gene: ENSMODG00000000092   Transcript: ENSMODT00000000117
Sequence length 883
Comment pep:novel chromosome:BROADO5:1:198541462:198562520:1 gene:ENSMODG00000000092 transcript:ENSMODT00000000117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HGAAAPRMALRRSMEWPRLRLRLPLRFSQLLLAGLAALLLPELSAAGLKLIGAPLKLTVS
QGQPVKLNCSVEGLEEPEIQWVKDGAVVQSVDQVYIPISEQHWIGFLSLKSVDRSDAGRY
WCQVEEGGETETSQPVWLTVEGVPYFTVEPEDLTVPNAPFQLSCEAVGPPEPVTIFWWRG
GTQVGEPALSPSILNVTGVTQSTVFSCEAHNLKGLASSRPATVYLQALPAAPSNVTVTRL
SSNNASVAWIPGSDGQALLHSCTVQVTEAPGGWEVLAVVVPVPPFSCLLRGLEPATNYSL
RVRCTNALGPSPYADWVPFQTQGLAPSSAPQNLHAIRTDYGLILEWEEVIPESSSESPLG
PYRISWVQENGTQGEMTVLGTRANLTGWDPLKDLTARVCVSNEVGCGPWSQPLLVSYRDG
AGQQGPPHSRTSWVPVVLGVLTALVTAAALALILLRKRRKETRFGQAFDSVMARGEPAVH
FRAARSFNREGPERIEATLDSLGISDELKDKLEDVLIPEQQFTLGRMLGKGQFGSVREAQ
LKQADGSFEKVAVKMLKADIINSSDIEEFLREAACMKEFNHPHVAKLIGVSLRSRAKGRL
PIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLIRFMVDIASGMEYLSSQNFIHRDL
AARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVW
AFGVTMWEIMTRGQTPYAGIENAEIYNYLISGNRLKQPPECLEEVYELMYQCWCSDPKQR
PTFPTLRMELEEILGRMSVLSASRDPLYINIEKAEEQAEEGSQLGGDQAVSGDGDRNSNG
TGPVGGIPSDYRYILTPGRLAEQSGEEQQSEGACGEAQRRMLL
Download sequence
Identical sequences F6YC68
13616.ENSMODP00000000113 ENSMODP00000000113 ENSMODP00000000113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]