SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000259 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000259
Domain Number 1 Region: 42-144
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000358
Family V set domains (antibody variable domain-like) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000259   Gene: ENSMODG00000000218   Transcript: ENSMODT00000000263
Sequence length 218
Comment pep:novel chromosome:BROADO5:1:398748864:398825946:1 gene:ENSMODG00000000218 transcript:ENSMODT00000000263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAFVVTLGIFHSLGLYLQLSGATRPGVQAPWDNHISGNALFTETPHDMTARSGEDVEMA
CSFRGSGSPSYSLEIQWWYVRNHKDWTDKQTWASNQLKASQQEEAGKEATKISVVKVVGS
NISHKLRLSRVKPTDEGTYECRVIDFSDGKARHHKVKAYLRVDPGENSVLHHHGHGPSLH
LQDTPLLGGQPAAPAPPPPPPKPGKELKKRSVDAACAL
Download sequence
Identical sequences F6SZJ5
ENSMODP00000000259 ENSMODP00000000259 XP_001381772.1.35504 13616.ENSMODP00000000259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]