SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000278 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000278
Domain Number 1 Region: 567-769
Classification Level Classification E-value
Superfamily Fibronectin type III 8.69e-42
Family Fibronectin type III 0.0000419
Further Details:      
 
Domain Number 2 Region: 1176-1372
Classification Level Classification E-value
Superfamily Fibronectin type III 3.32e-39
Family Fibronectin type III 0.0000128
Further Details:      
 
Domain Number 3 Region: 969-1176
Classification Level Classification E-value
Superfamily Fibronectin type III 1.17e-34
Family Fibronectin type III 0.0000204
Further Details:      
 
Domain Number 4 Region: 769-958
Classification Level Classification E-value
Superfamily Fibronectin type III 1.52e-33
Family Fibronectin type III 0.000035
Further Details:      
 
Domain Number 5 Region: 1707-1904
Classification Level Classification E-value
Superfamily Fibronectin type III 5.08e-32
Family Fibronectin type III 0.0024
Further Details:      
 
Domain Number 6 Region: 1375-1524
Classification Level Classification E-value
Superfamily Fibronectin type III 9.61e-29
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 7 Region: 1557-1708
Classification Level Classification E-value
Superfamily Fibronectin type III 8.57e-27
Family Fibronectin type III 0.00062
Further Details:      
 
Domain Number 8 Region: 378-470
Classification Level Classification E-value
Superfamily Immunoglobulin 4.29e-21
Family I set domains 0.0087
Further Details:      
 
Domain Number 9 Region: 277-376
Classification Level Classification E-value
Superfamily Immunoglobulin 1.81e-19
Family I set domains 0.01
Further Details:      
 
Domain Number 10 Region: 2-69,113-168
Classification Level Classification E-value
Superfamily Immunoglobulin 7.76e-19
Family I set domains 0.023
Further Details:      
 
Domain Number 11 Region: 476-572
Classification Level Classification E-value
Superfamily Immunoglobulin 1.68e-17
Family I set domains 0.021
Further Details:      
 
Domain Number 12 Region: 191-291
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000575
Family I set domains 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000278   Gene: ENSMODG00000000232   Transcript: ENSMODT00000000282
Sequence length 2123
Comment pep:novel chromosome:BROADO5:6:78969376:80023936:1 gene:ENSMODG00000000232 transcript:ENSMODT00000000282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVAPYFKTEPGLPQIHLEGNRLVLTCLAEGSWPLEFKWICNDNEITTYTSEYKYIIPSLE
RTDAGFYRCVVRNRMGALLQRKSEVQVAYMGNFIDADQRKTVFQGGAAVLNLPHIISYPR
PQVTWFRDGHKIIPSSRIAITLENQLVILATTAGDTGGYYVQAVNEKNGENKTSPFTYLS
IESESDTPDIMAPVIVIPPGNTSVVAGTSEVTLECIANARPIEELSMTWKRNGVKITNGL
HNLGRRLTITNPTSSDIGMYICEAELKGTNFEPARTKAFLSIIEPPYFTAEPENRILAQV
EKTVDITCQAMGVPVPNLEWYKDSVPISKLRNSRYKVLVSGGLRIQKLHPDDSGIFQCFA
RNEGGEIETHTYLDVTNIAPTFTLRPVDTTVTDGMTAMLTCEVSGAPKPAITWRRGKQIL
ASGSVQIPRFILLESGGLQITPVFLQDAGNYTCYAVNSEGSLNAFAMLTVWNRTFIVFPP
EDRTVIKGTTATLHCGAIHDPRIPIRYVWKKDNIVINPATSSRIVVEKDGSLLISQTWSG
DIGDYTCEVISEGGNDSRMARLEVIELPHSPQNLLASLNSSHSRTVMLSWVRPFDGNSPV
LYYIVELSENNSPWKVHLSNVDPEMTSVTVSGLTPARTYQFRVCAVNQVGKGQHSAETSR
LMLPEEPPSAPPKNIVASGRTNQSIMVQWQPPPETEHNGVLHGYILRYRLAGLPGEYQHR
NITSPEINYCLVKDLIIWTQYEIQVAAYNGAGLGTFSRAVTEYTLQGVPTAPPQNVQTEA
LNSTTIQFLWNPPPQQFINGINQGYKLLAWPVDVPEALITVTIAPDFHGIHHGFITNLKK
FTAYYTSVLCFTTPGDGPRSPPHLIWTHEDKPGAVGHLSFTEILDTSLKVSWQEPVEKNG
IIIGYQISWEVYSRNDSRLTLTLNNTTHEYKIKGLSSLTTYTIEVAAVTATGIGLVTSST
ISSGVPPELPGAPSNLVISNISPRSATLQFRPGYDGKTSISRWIVEGQIGAIGDEEEWSC
LYEEENEPDAQMLEIPNLTPYTHYRFRMRQVNIVGPSPFSPSSRVIQTLQAPPDIAPASV
TVRTASETSLWLRWVPLPDSQYNGNPESVGYRIKYWRTDLQSSVMVQVISDRLEREYTIE
ELEEWTEYELQMQAFNAIGAGPWSEMVRGRTRESVPSAAPENVSVEAVSSTQILITWASV
PEQDQNGLILGYKILFKAKDLDSEPKTHVVRGNHTQSVLLAGLRKYVLYELQVLAFTRIG
NGVPSSPPILERTKDDAPGPPVRLVFPEVRLTSVRIVWQPPEEPNGIILGYQIAYRVATS
SPNKFTTVEVGSTVRQFTATDLTPESAYIFRASAKTRQGWGEPLEATVITTEKRDRPAPP
RHLLIPQSEVTSRSLQLQWVPGSDGSSPIRYFTVQIRELPRGEWQTYSSSISHEATAHVI
ERLNPFTSYKLRLKATNDIGDSDFSAETEAVTTLQDVPGEPPNCVSVTPHTTSSVLVQWQ
PPRDESLNGLLVGYRIYYRELEYETGPGTESKTVKNPSALRAELTPQSSFKTVNSSSALT
TYELTHLKKYKRYEVIMTAYNIIGESPASAPVEVFVGEAAPAMAPQNIQVNPLTASQLEV
IWDPPPVESQNGIIQGYKAILLMAIYYWEADSQNDTENMKVLFLPETMVRLKNLTSHTKY
LVSISAFNAAGDGPKSEPRQGRTQQAAPGAPSFLAFSEITSTTLNISWGEPVAANGVLQG
YRVVYEPLAPVQGVSKVVTVDIKGNWQRWLKVRDLTKGVTYFFRVQARTITYGPGLQANI
TAGPAEGSPGSPRDVLVTKSASELTLQWMEGNPGDRPTTGYIIEARPSDEGLWDMFVKDI
PRSATSYTVGLDKLRQGVTYEFRVVAVNDFGYGEPSSPSVAVSAQSETPFYEEWWFLLVM
ALSSLILILLVVFALVLHGQNKKYRNCNTGKSISNMEESVTLDNGGFAALELNSRHLNVK
STFSKKNGTRSPPRPSPGGLHYSDEDICNKYNGAVLTESANLKEKSVDASESEATDSDYE
DELPKHSFVNHYMSDPTYYNSWKRQAKGVKHPAAYRYEECAANDAEPYFQTVITTQSAGG
VYTPTGQQAPGSRTPVTGFSSFV
Download sequence
Identical sequences F6SYK6
ENSMODP00000000278 ENSMODP00000000278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]