SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000371 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000371
Domain Number 1 Region: 2-73
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000157
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 263-347
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000757
Family I set domains 0.016
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000000371
Domain Number - Region: 169-245
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000189
Family V set domains (antibody variable domain-like) 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000371   Gene: ENSMODG00000028604   Transcript: ENSMODT00000000378
Sequence length 994
Comment pep:novel chromosome:BROADO5:2:104703872:104716554:1 gene:ENSMODG00000028604 transcript:ENSMODT00000000378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSGEPRPEVQWYRTQGDLSDSNKYKIFSQPGGKEHVLQVNKLTGDDTDTYRCLAVNEYG
EAMCSARLTVIEVGFRKNRKRRNEPQEDHRKELMDFRKILKKRAPPPPPEKKMDREQVWQ
LLMNSDRKDYERICMKYGIVDFRGMLRKLQEMKKEQEDKISQYINTISNLRHIKVTKDGL
ATFDLELDLKDFESKIYLYKDGEMIHYGYGNETKHCLRRLGKRYYFHVQDLQPEDAGIYQ
VKVEDVEVFSTELEADVIPARVVNPLAETLCEVQEDAVFECTLSNPCPHAFWQFQHRPLR
PSDKYEVSVSPDGLTHRLVVRGAQRSDMGLYSLGTGLHSSSAWLVVEGEKDKGFLPTRQG
KKTDEVGNDERNRLQAEEAPFSDVKNSEKLIKEVKPGDWSQLGEPIKDDGLPYGLHITGG
QHGGGQDGPRGYNNFPMEKEGIADLAWDLDEVMENKGVCRAEGNRDTLLERNQLPKVGGQ
GVSFPGGYGLQGDGWESGMDFMIRQQQDCGGNKTKSRQWEVGESLEASTGGLQGKGWQNN
LKGKEDREDSGGQLGNYSQGNIGDLGTGERSLVTSQTSPVGSWKKGRKLGMSLEADFNLE
LEGRDDFSSKRGQYRPPCLGEAGEKQAQRTGQGDGSSGAGSTEAWEPLGWNKGNGEKLRD
FQVQRLSHSKKSFLGQKDLGEEVDISLEEAGYKASLGETESLGKEPIVRRTGFKAGPWAL
GSDGGEGYGHSMEDLHELKGRGLGPRDSQGVPKSLGGLLGESSRELGYFQGWPADQSEAG
YRDDKVESEGMMSSWDDTSYNFRKIGPEDGLGTLRIMESGRRGDKGISVKAGELMGSGNR
ASFGDGPRDHWIKDRAVYKDGSGDWETQGSGSKRGSRDDVKGSEGMRSNYGASLKDIPED
RQIKKPGGVGGCTGGLEAPEAMGSRSMESNKDYLGSPRKIRLRGEESFRSDLEGYGSDFG
GPERIGSESEGGIRVXXXXXXXXXXXXXXXXXXX
Download sequence
Identical sequences F6VV43
ENSMODP00000000371 ENSMODP00000000371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]