SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000372 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000372
Domain Number 1 Region: 630-820
Classification Level Classification E-value
Superfamily Fibronectin type III 1.85e-38
Family Fibronectin type III 0.0007
Further Details:      
 
Domain Number 2 Region: 1040-1134
Classification Level Classification E-value
Superfamily Immunoglobulin 4.04e-19
Family I set domains 0.0078
Further Details:      
 
Domain Number 3 Region: 515-622
Classification Level Classification E-value
Superfamily Fibronectin type III 9.58e-18
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 4 Region: 922-1018
Classification Level Classification E-value
Superfamily Fibronectin type III 7.99e-17
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 5 Region: 443-536
Classification Level Classification E-value
Superfamily Immunoglobulin 2.04e-16
Family I set domains 0.022
Further Details:      
 
Domain Number 6 Region: 345-430
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000908
Family I set domains 0.032
Further Details:      
 
Domain Number 7 Region: 841-930
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000395
Family I set domains 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000372   Gene: ENSMODG00000000312   Transcript: ENSMODT00000000379
Sequence length 1137
Comment pep:novel chromosome:BROADO5:2:104718806:104740009:1 gene:ENSMODG00000000312 transcript:ENSMODT00000000379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLGSPGTEKESRNSNISGWGQDAHSRLGGKNVCTRAGDQGIGDTWTGRNLRPDNSGVNI
KYRHQDIGVQDTPEAKDTTINGIQGVLNGTEGNDFCDGRMSVPGQAGAGRWGGAGSLDGR
GGVSGSAKGSGVLGGMNSSQWRDSCANGIQQSGMEGALKGKDGRKSYRDKSGETRDSETM
LGKGVDLDGKDPSGVREDLESLNGKNIRPKGPRSLDNYERRDGGGTSPSTWGGKTRTGTK
DFARSEGRESQVWNGSQSGLGARREISDRQKLEEGRVWGSRYGTESRSVPEEPQKGDHQN
RDSMGHESNKNDGLDRISTSSKPRYRNKQNSSNFFEEIQGLSGHFSQELADMEAKKGEEA
VLSCTLTSDLLSGAWFKEGVKLTAEDGVIFEQDGSSYRLRIPQVQEAQAGKYMFVAGDHM
SEATLTIREPLTIAQDMLEKLKEPLVVKAGKTVTVKIPFSGQAPVRVTWKKDGAEVVGGP
KGAQLDQGDNFTRLCLPSASRKDSGQYLVKLTNAGGSMEAQLTLKVIDKPQHPQGPLKVQ
YCRGAGISLSWQPPRDDGGQVVLTYVVERQQAGRTTWLKLGETPGNVTTFSDTRVEQGKK
YTYRVRAVTSEGSGEALVSEELLVASEACPRPPPPPTIVAATSQGITLTWTAPQGPGSAQ
LLGYIIEKRKKGSNTWTAVNDQPIPEKKWTVSDVLQGCQYEFRVTAVGASGPGEPGSSSD
AVYARDPMRPPGSVRDLQVTDISHASITLSWSRPDPQDGDQVQGYVVELRSSDSLQWSRC
HTGTVGGTTYTTKGLRPQEFYFLRVTAVNDGGQSQPTTLDTCIQAMPVSVYPKFLMDTTT
TDCVTVKSGDTVRVPVSFEASPMLEVIWLKDGLSLPKRTVTTIRDGLTQLLIPAASLSDG
GLYTVMLRNLQRKEVTYSFLIRVSASPAAPGPIRLEENVPGTVTAVWEPSPDDGQGGPLY
YTVLTRSSIHVTWREAGDRIHTNRFTLVGVLPGHQYYFRVVAKNELGASEPSDTMEPWSI
PRQREKFMVKMPNFKKPNLTQKPHFLVNLRTHLLPQGCECCMSCAVKGEPRPRVTWFKDD
QSLEGNPNVYSTDVLGVCSLVIPSVTLKDSGKYKAVAENGLGQAVSQATLIVTESCF
Download sequence
Identical sequences F6VV34
ENSMODP00000000372 ENSMODP00000000372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]