SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000387 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000387
Domain Number 1 Region: 99-223
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000702
Family V set domains (antibody variable domain-like) 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000387   Gene: ENSMODG00000000324   Transcript: ENSMODT00000000395
Sequence length 380
Comment pep:novel chromosome:BROADO5:Un:6787375:6826713:-1 gene:ENSMODG00000000324 transcript:ENSMODT00000000395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCASAPTWANKAAGAPSRLLGVLYPLTRSLWLAGLTCCRSVTQRGFCWGCRQLSSQAPDT
PQPGTPTLTMELRPGAALGPWGLLLLALCLASSRGQVAALKITIPYSLYVCPEGQNISLT
CRISGPFTDRHDLLYKTWHMGHRENQSCSEKMSIRNVTERELHPRHGGHHANASGQNPAG
HKNLTLHHGVELTSDHHGNFSITLLNLTQQDGGIYCCLVVEYKHHHLEQEVHGFVELQVQ
KGQVPLSKCTLHPATPPENENITAAALATGACIVGILCLPLILLLVYKQQQAASNRRAHE
LVRMESNAQGIENPVFEAVTHGIPELKSRPPLSYMAQRQPSESGRHLLSEPSTPLSPPGP
GDVFFPSLDPVPDSPNAEAI
Download sequence
Identical sequences H9H5W4
ENSMODP00000000387 XP_007505694.1.35504 ENSMODP00000000387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]