SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000409 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000409
Domain Number 1 Region: 54-228
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 1.55e-41
Family MHC antigen-recognition domain 0.0000702
Further Details:      
 
Domain Number 2 Region: 240-312
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000005
Family C1 set domains (antibody constant domain-like) 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000409   Gene: ENSMODG00000000345   Transcript: ENSMODT00000000418
Sequence length 343
Comment pep:known chromosome:BROADO5:4:121218557:121305227:1 gene:ENSMODG00000000345 transcript:ENSMODT00000000418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGDWRDWRDLCLFFWSKFLRVQECQNSLHRPASCKVQLSQRRFLGIQRALDSGLHSLQY
NFIAISNSDQESFSYSALVYLDDQLFLHYGSKSQLELRSTSLEVVIPPDIWKKESENLKG
MRWKLRATLAKITQQSQEKDGSHTLQVILGCDLLKNGKTRGCLEYGYDGENFLTFQPETL
TWEDYYHPAANSIKNDFATDLIDTKLNKAKVEQECPQQLQGYLAVLKEKKASPSLHVTSK
LNNLWVCWAYNIFPGDVKITWLKDGQALNQKEQESGILRPSGDGTYQTSVSIYANPKELN
YKCHVEHQGKNQTKAIPSGSVRKEFQIIFVNPVVIVIIFNLRE
Download sequence
Identical sequences D7URV5
ENSMODP00000000409 ENSMODP00000000409 NP_001180253.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]