SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000443 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000443
Domain Number 1 Region: 36-138
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000203
Family V set domains (antibody variable domain-like) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000443   Gene: ENSMODG00000000370   Transcript: ENSMODT00000000453
Sequence length 200
Comment pep:novel chromosome:BROADO5:4:265341077:265367470:1 gene:ENSMODG00000000370 transcript:ENSMODT00000000453 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTLRSWRRRNRGITLGLFALCLAAARCLQSQGVSLTIPQPNINATVAQNIVLAIDYSCH
GVPTIEWKYTSYWGMQKIVEWQPGNQANISQSHKNRVCTYDNGSIQLLKVGVRDTGYYTV
TVTEGLGSSQFGTIVLHVSEILYEDLHFVAVVLAFLGTMATVLISLMWVCNKCSYKFQKK
RRHKLKESTTEEIELQNIDC
Download sequence
Identical sequences F6R959
ENSMODP00000000443 ENSMODP00000000443 XP_001368746.2.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]