SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000524 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000524
Domain Number 1 Region: 592-798
Classification Level Classification E-value
Superfamily Fibronectin type III 1.55e-33
Family Fibronectin type III 0.00094
Further Details:      
 
Domain Number 2 Region: 800-984
Classification Level Classification E-value
Superfamily Fibronectin type III 4.42e-26
Family Fibronectin type III 0.00029
Further Details:      
 
Domain Number 3 Region: 306-399
Classification Level Classification E-value
Superfamily Immunoglobulin 8.58e-23
Family I set domains 0.00034
Further Details:      
 
Domain Number 4 Region: 412-500
Classification Level Classification E-value
Superfamily Immunoglobulin 1.79e-20
Family I set domains 0.02
Further Details:      
 
Domain Number 5 Region: 222-309
Classification Level Classification E-value
Superfamily Immunoglobulin 1.39e-19
Family I set domains 0.0034
Further Details:      
 
Domain Number 6 Region: 125-203
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000397
Family I set domains 0.00046
Further Details:      
 
Domain Number 7 Region: 19-109
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000771
Family I set domains 0.00069
Further Details:      
 
Domain Number 8 Region: 494-598
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000351
Family I set domains 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000524   Gene: ENSMODG00000000441   Transcript: ENSMODT00000000538
Sequence length 1023
Comment pep:novel chromosome:BROADO5:4:255587777:256219506:1 gene:ENSMODG00000000441 transcript:ENSMODT00000000538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLEGFESMPFSVSIESVDYGPVFVQEPDDIIFPTDSDEKKVALNCEARGNPVPNYRWLR
NGTEIDLESDYRYSLIEGNLIISNPSEAKDSGHYQCLTANFLGSILSREAVLQFAYLGNF
SGRTRSAVSVREGQGVVLMCSPPPHSPEIIYSWVFNEFPSFVAEDSRRFISQETGNLYIS
KVQTSDVGSYICLVKNTVTNARVLSPPTPLTLRNDGVMGEYEPKIEVHFPYMVTAAKGMT
VKMECFALGNPVPTISWMKVNGYIPSKARLRKSQGVLEIPNVQLDDAGIYECRAENSRGR
NSFRGQLQVYNYPHWVEKLNDTHLDSGSALRWECKATGKPRPTYRWLKNGVPLLSQSRVE
MVNGILMIHNVNQSDAGMYQCLAENKYGSIYASAELKVLASAPAFALNQLKKTIIITKGQ
EVLIECKPQGSPKPTISWKKGDKAVRESKRIAILPDGSLRILNASKSDEGKYICQGENVF
GSAEILASVFVKEPTRIELTPKRTELTVGESVVLNCKAIHDTSLDVSFYWTLKGQPIDFE
KERGHFESIRAQASSADLMIRNILLMHAGRYGCRVQTTADSVSDEADLLVRGPPGPPGIV
IVEEITETTATLSWSPAADNHSPISSYNLQARSPFSLGWQTVKTVPEVITGDMESAMAVD
LNPWVEYEFRVVATNPIGTGDPSTPSRMIRTNEAVPKTAPANVSGRSGRRHELVIAWEPV
SEEFQNGEGFGYIVAFRPNGTRGWKEKMVTSSDASKFIYRDESVPPLTPFEVKVGVYNNK
GDGPFSNIVVICSAEGEPSAAPTDVKATSLSVSEILVAWKHIKESLGRPQGFEVGYWKDM
EQEEAAETVKTGGNESSIILTGLEGNTLYHLTVRAYNGAGYGPASSEVRAATKKSPPSQA
PSNIMWEQQGSQVSLGWEPVRPLANESEVVGYKVFYRQEGHSNSQVIETQKTQAVVLLPD
VGVYIIEVRAFSEGGDGTASSQIRVPSYSGGKITSAQSSLHTFSTSSSSITLLLALMVPS
TSW
Download sequence
Identical sequences F6UT36
ENSMODP00000000524 ENSMODP00000000524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]