SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000529 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000529
Domain Number 1 Region: 368-628
Classification Level Classification E-value
Superfamily YWTD domain 6.15e-55
Family YWTD domain 0.0000000229
Further Details:      
 
Domain Number 2 Region: 161-198
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000131
Family LDL receptor-like module 0.00056
Further Details:      
 
Domain Number 3 Region: 76-112
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000445
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 4 Region: 197-238
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000563
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 5 Region: 4-42
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 6 Region: 110-150
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000602
Family LDL receptor-like module 0.00077
Further Details:      
 
Domain Number 7 Region: 285-327
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000474
Family EGF-type module 0.0037
Further Details:      
 
Domain Number 8 Region: 243-275
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000524
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 9 Region: 321-361
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000183
Family EGF-type module 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000000529
Domain Number - Region: 639-679
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000105
Family EGF-type module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000529   Gene: ENSMODG00000000446   Transcript: ENSMODT00000000543
Sequence length 823
Comment pep:novel chromosome:BROADO5:2:1929481:1966488:1 gene:ENSMODG00000000446 transcript:ENSMODT00000000543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAKKTCSDSDFTCDNGHCIPERWKCDGEEECPDGSDESETTCSECWGGAPPQCSLPCQGQ
KALSLPSGQAGIGDDLCSPSEFQCGNRTCIATVFVCDGDDDCGDGSDERGCPAQGCGPQE
FRCNGSSCIPERWLCDGQADCDDRSDEAPERCGRGAGTEAPATCGAGEFPCGSGECIHLT
WKCDGDADCKDKSDEASCASVTCGAEEFQCADGTCVPRARRCDREPHCPDGSDEAGCLQE
SVCQSPGRFHCKSGECVDGSKVCDGRGDCRDGSDEPVTECEADECVHNNGGCSHICRDLK
LGYACECPPGYELLDKKTCGDINECDNPDACSQICINYKGYFKCECHAGYEMDTLAKTCK
AVGTSPSLIFTNRHEVRRINLGKRDYAPLLPMLKNVVALDVDVAANRLYWCDLFYRKIYG
AFIDKASDRAEQAVLIDSQLHSPEGLAVDWVHKHLYWTDSGNKTISVATVDGGRRKTLFS
HDLSEPRAIAVDPLHGFMYWSDWGDQARIEKSGLNGVDRQVLVLDNIEWPNGITLDLLSQ
RLYWVDSKLHQLSSIDFNDGNRKVLIFSVNTLSHPFGIAVFEDKVFWTDLENEAIFSANR
LNGLQISVLAENLNNPHDIVIFHELKQPKAPNACEQSSQPNGGCDYLCLPAPQISVHSPK
YTCACPDSMWLGPDMKRCYRAPPSTSTTTLASPTTRTAGTRLPTSPFLPPGHTGALSPGD
ASLSPGTGRSEPTISPSMPGLPSPGNSNHSQHSTAAIIGIIVPVGVIALLGMSGYLIWRN
WKRKNTKSMNFDNPVYRKTTEEEDEDEIHIGRTATQIGHVYPA
Download sequence
Identical sequences F6USZ0
ENSMODP00000000529 ENSMODP00000000529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]