SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000573 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000573
Domain Number 1 Region: 221-312
Classification Level Classification E-value
Superfamily Immunoglobulin 2.35e-19
Family I set domains 0.0092
Further Details:      
 
Domain Number 2 Region: 131-210
Classification Level Classification E-value
Superfamily Immunoglobulin 7.6e-16
Family I set domains 0.019
Further Details:      
 
Domain Number 3 Region: 71-141
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000223
Family I set domains 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000573   Gene: ENSMODG00000000482   Transcript: ENSMODT00000000588
Sequence length 354
Comment pep:novel chromosome:BROADO5:2:19185005:20142328:1 gene:ENSMODG00000000482 transcript:ENSMODT00000000588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDIMMLVQGACCSNQWLAAVLLSLCCLLPSCVILGKSLDSPCLSLTALQLTSFSLAIGRC
YLEDGASKGAWLNRSSIIFAGSDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDGPYTCSV
QTQHTPRTMQVHLTVQVPPKIYDISTDMTVNEGTNVTLTCLATGKPEPSISWRHISPSAK
PFESGQYLDIYGITRDQAGEYECGAQNDVSFPDVKKVKIVVNFAPTIQEIKSGTVAPGRS
GLIRCEGAGVPPPAFEWYKGEKKLFNGQQGIIIQNFSTRSILTVTNVTQEHFGNYTCVAA
NKLGTTNASLPLNPPSTAQYGITGSAEVLLSCWSLVLSLPSLTSILYLKDIILQ
Download sequence
Identical sequences F6UA66
ENSMODP00000000573 ENSMODP00000000573 13616.ENSMODP00000000573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]