SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000696 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000696
Domain Number 1 Region: 93-231
Classification Level Classification E-value
Superfamily L domain-like 5.83e-36
Family Ngr ectodomain-like 0.0032
Further Details:      
 
Domain Number 2 Region: 322-439
Classification Level Classification E-value
Superfamily Hormone receptor domain 2.75e-17
Family Hormone receptor domain 0.0041
Further Details:      
 
Domain Number 3 Region: 252-355
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000383
Family I set domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000696   Gene: ENSMODG00000000582   Transcript: ENSMODT00000000711
Sequence length 1333
Comment pep:novel chromosome:BROADO5:5:206170768:206335957:1 gene:ENSMODG00000000582 transcript:ENSMODT00000000711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPAGRSGPVSERRRYAGRWRRRLVLGWVLWIALWESSPGATALPPGCKHDGRPKGASKP
SAGGAAAAAALEGKVVCSSLDLAQVLPPDTLPNRTVTLILSNNKISELKNGSFSGLSLLE
RLDLRNNLISTIDPGAFWGLSSLKRLDLTNNRIGCLNANIFRGLTNLVRLNLSGNLFSSL
AQGTFDYLGSLRSLEFQTEYLLCDCNILWMHRWVKERNITVRETRCAYPKSLQAQPVTGV
KQELLTCDPPLELPSFYMTPSRRQVVFEGDSLPFQCMASYIDQDMQVLWYQDGRIVETDE
SQGILVEKNMIHNCSLIASALTISNIQAGSTGNWGCHVQTRRGNNTRTVDIVVLESSAQY
CPPERVINNKGDFRWPRTLAGFTAYLLCPRNTPGSGIYPGNPQDERKASRSCERGGFWAK
DNYSRCQYANDVTRVLYMFNQMPLNLTNAVATARQLLAYTVEAANFSDKMDVVFVAEMIE
KFGRFTKEEKSKELGDVMVDIASNIMLADERVLWLAQREKKACSRIVQCLQRIAAYRLAN
GAHVYSTYSPNIALEAYVIKASSFTGMTCTVFQKVATSDRTGLTDYGRRDPDGNLDKQLS
FKCNVSNTFSSLALKNTIVEASIQLPPSLFSSKHKRETRLADESIYKLQLIAFRNGKLFP
ATGNSTNLADDGKRRTVVTPVILTKMDGINIDTQHIPINVTLRRIAHGADAVAAQWDFDL
LNGQGGWKSDGCHILSADENVTTIQCYSLTSYAVLMDLTGSEVYSQSADLLHPVVYATSI
ILLLNLLMIIISYIYHHSLIRISLKSWHMLVNLCFHIFLTCGVFVGGITQTKNTSICQAV
GIILHYSTLATVLWVGVTARNIYKQVTKKAKRCQDPDEPPPPPRPMLRFYLIGGGIPIIV
CGITAAANIRNYGSRPNAPYCWMAWEPSIGAFYGPASFIIFINCMYFLSIFIQLKRHPER
KFELKEPAEEQQRLATSEHGEVNHQDSMSLSLVSTSALENEHPFHSQLLGASLTLLLYVA
LWILGALSVSLYYPLDLVFSCFFGATCLSLSAFVMMHHCVNREDVRLAWIATCCPGRSAY
SVQVNIQPSSSIGTNGDAPKCTNSSAESSCTNKSASSLKNSSQGCKLTNLQAAAAQCHSN
SLPLNTVPQLDNSLTEHSVDNDIKMHVAPVEVQFRTNGHPGRHHKNRSKGHRASRLTVLR
EYSYDVPTSVEGSVQNGLPKSRPGNNEGHSRSRKAYLAYRERQYAQPQQDSSDAGSTLPK
SSRNFEKTITASSKKDGVRKPIVVELESQQKSYGLNLAIQNGPLKSNGQDGPLLSTDSTG
NIRTGLWKHETTV
Download sequence
Identical sequences F6WP14
XP_001368138.1.35504 ENSMODP00000000696 ENSMODP00000000696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]