SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000735 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000735
Domain Number 1 Region: 1059-1339
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.32e-99
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000259
Further Details:      
 
Domain Number 2 Region: 1351-1623
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.75e-36
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00044
Further Details:      
 
Domain Number 3 Region: 125-206
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000962
Family Fibronectin type III 0.004
Further Details:      
 
Domain Number 4 Region: 215-292
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000343
Family Fibronectin type III 0.0035
Further Details:      
 
Domain Number 5 Region: 762-846
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000889
Family Fibronectin type III 0.0069
Further Details:      
 
Domain Number 6 Region: 37-126
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000119
Family Fibronectin type III 0.0056
Further Details:      
 
Domain Number 7 Region: 303-378
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000142
Family Fibronectin type III 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000000735
Domain Number - Region: 648-684
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0144
Family Fibronectin type III 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000735   Gene: ENSMODG00000000614   Transcript: ENSMODT00000000752
Sequence length 1632
Comment pep:novel chromosome:BROADO5:2:106077008:106114275:1 gene:ENSMODG00000000614 transcript:ENSMODT00000000752 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPLLFLAVLLGLPGASAEEDGCNQVEVSAEEEAGGQPLQVNISRQGQPTSLVLNWGAPV
PTRLGYALHLARLGLPGPLEKLQFQAGPNTSGFEFQDLVPGSHYQLEVTVLLPCSQNSTL
TLTAQTTPSPVRSLRLNNSGSPSSLEATWGSAPGEHNGYQLLLYHLETQTLARNISVSQE
ILSYHFDSLLPGSEYALWVITWAGDLHAKTNICQWTTPVPPEQLDLSAVGPSTLQASWRR
AEGAAWFYLTLLDLLNGTILTAVVKRGTTNHTFYNLSPGYPYQLSLSATAGLLQAGGPNA
TGWTYPSAPLDLVLTPWPPGLSASWQAGPGTRDGYLLRLSGQAERNSTMGPEALNATFPG
PLPAGHYTLELTALAGPHGASAQTDTWLECMASLQALLMGISIMIWGYPSILGLPGPGII
LTSPWGLYISRKVIVCQVPPGRKRETLSRTLDHLSCFLTFLSESAPQTGLSNICLWSDLL
VMGIDERGHVKGDRVGSHISPRTTLWSPQLPRMTQSRRPYLFVNVENHKWRHFLHSFRIQ
PVSFSFPPPPHLSHNQRAIPLGITCVLASNPFPCCWYLHKGVHLESLLNHVPSTPVVKQL
LFFYVFTPTVCPLLVDSTRPQPGVLQLTGLEASKESGRRALLYVEGSPEIIANVSVLPSA
TQVTFRGLVPGAQYRVDVILASGVTTQSLVGHTWWHNGEMMASMGKGRVDPIWACTPKAT
CVLGLARLILRDLIPGGTFSLSVLCQVGPLKASTSPIVLLIEPRPVEDVQCQPEATHLAL
NWTVPGGEVGTCLVVAERLVTGGKTQPVFSANTTQNAVLLSGLIPATSYRLSLTLLGRNG
LWSQMVTLLCTTSPEAWHLPEMAAAPRLEPEAGAGVVITRDMFGEDNGQIQWYGVIATTN
ASVVQPSQETISHTWYDHYYRGLDSYLAVLLPSPFRPGPWAMPRSWTVPVGTEDCGQTQQ
TCNGKLKPDAQYRFSIAAFTSSDPVNPTVSFTAFSEPRASVSGASVPLLVASGIVSGCLF
TLCAVLGLLCWRRVWAERAEKNHFSQEMTPYSLRNIRRPILIQNFRQSYEAKKANAHHAF
FQEFEELKEVGKEQPKLEAEHPANAIKNRYPHVLPYDHSRVRLSQMDSEPHSDYINANFI
PGYTQPQEFIATQGPLKKTLEDFWRLVWEQKVHTIVMLTVGMENGRVLCEHYWPLDSAPV
THGQITIHLLAEETGEDWTSREFQVQHGPQQQERWIQQLQFTAWPDHGVPEAPSSLVTFA
ELVQERVRAAQGTAPTLVHCSAGVGRTGTFVALARLLQQLQEEQAVDVFNTVYALRMHRP
LMIQTPAQYIFLHSCLLDKILEEPAGSPVSRPIPVKNFSQQHAKRSAHFNAGFLREYELL
VEAIKDQESSARHQLGSAISQLLPYERWRVKFSPLEQSPVDSVQAWLFPGGPSGRDQVAL
SGPAKAEEFWQLVWEHGAHVLVSLCPLGTQNEVRSLEWWPSVEQPICTEALTVHWVAESD
VAGWSCLHLSVKHEKKGKELQVQQLRFPCWECGQEPPVQTLLPFLATVGQCCSRVKSKKP
ATVLVYSSSGMVQLGMLLALERLLQQAESQNSVDIFGVVLQLARACGSMTPTLDQYIYLY
GCVGSALANGQT
Download sequence
Identical sequences F6TAZ7
ENSMODP00000000735 ENSMODP00000000735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]