SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000796 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000796
Domain Number 1 Region: 48-143
Classification Level Classification E-value
Superfamily Fibronectin type III 5.4e-42
Family Fibronectin type III 0.00012
Further Details:      
 
Domain Number 2 Region: 152-249
Classification Level Classification E-value
Superfamily Fibronectin type III 8.53e-18
Family Fibronectin type III 0.0000471
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000796   Gene: ENSMODG00000000667   Transcript: ENSMODT00000000814
Sequence length 562
Comment pep:novel chromosome:BROADO5:8:91882031:91910982:-1 gene:ENSMODG00000000667 transcript:ENSMODT00000000814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPPYQMGPHSQLHPMSMTTYSPLPWYLPFFLLLFALPLIQGALKDSSQLSCFYNSRANI
SCTWSPEPTLRVEQCRIYAKSKLRTENQSCELLHVGPTFWTCNLILGEFNRQSLTAADVM
VMTVSCLMGEQRFVMEEDFEPFQRIRLMTLNDLSLNQQEEHTYNVSWNVPMCSHYLDKYL
VFEARYRIQGKPWEEAAVLSIKQDQRWVCIEKLSPDTEYEFQVRGKPERMTSAAVWSPWS
QTLVFRTKPQGSNFNYWLPHLIMGLCGTVAILLLLLLVYKWYPQKWLKKILKYHTPDPSK
FFSPLSTEHGGDFQKWLSSPFPTASFSTSILAPEISPLEVMQKEDPNLGLLLSKELVPAY
RSPETSGHSLSSCFTNQGYFFFHLPDALEVESCQVYFTYEPFNEEEEENKVEGNQGSLMP
QLHPGGPEDDSYCTFPPGDDMILFSPRLFQSPGNNLGPQSISCPGKEIKKETLPPEEHIA
TNPSCNPCFSALQNSLDLRPESVQNGSLLLGSGLGSVPPFPSADVPSAADQTRAVSSSYP
VLNTGAYLSLGELQNQYQTHSA
Download sequence
Identical sequences F6SBB8
ENSMODP00000000796 XP_007503510.1.35504 ENSMODP00000000796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]