SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000799 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000799
Domain Number 1 Region: 22-246
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.05e-90
Family Eukaryotic proteases 0.000000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000799   Gene: ENSMODG00000000671   Transcript: ENSMODT00000000817
Sequence length 247
Comment pep:novel chromosome:BROADO5:8:204930250:204934673:-1 gene:ENSMODG00000000671 transcript:ENSMODT00000000817 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAIIFLALLGAAVAFPTGDDDDKIVGGYTCAANSVPYQVSLNAGYHFCGGSLINSQWVV
SAAHCYKSRIQVRLGEHNIEVLEGNEQFIDSAKVIRHPNYNSYTIDNDIMLIKLKTPATL
NSRVSSITLPTSCAATGTSCLISGWGNTLSSGSNYPDLLQCLKAPVLSDSSCRNAYPGQI
TNNMICLGYLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCAQKGKPGVYTKVCNYVDWI
KTTIANN
Download sequence
Identical sequences F6SB70
ENSMODP00000000799 XP_001362226.1.35504 13616.ENSMODP00000000799 ENSMODP00000000799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]