SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000811 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000811
Domain Number 1 Region: 21-245
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.99e-83
Family Eukaryotic proteases 0.00000173
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000811   Gene: ENSMODG00000000681   Transcript: ENSMODT00000000829
Sequence length 247
Comment pep:novel chromosome:BROADO5:8:204970990:204974301:-1 gene:ENSMODG00000000681 transcript:ENSMODT00000000829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETDLTSNSNLFPPSVAFSNKNHEKIIGGNDCEKNSVPYQVYVRAANILCGGSLINAQWVL
SAAHCYQSQFQMILGAHTLNVLEGNEQIINSTKVIRHPSYQEENPNHDIMLIKLQKAATL
NSHVAKISLPTSCVTAGTDCLISGWGIYQINDSTYSNILQCLYAPVLSKSICHVAYPGMI
TENMICLGFMEGKKDTCQGDSGGPVVCEDQLQGIVSWGMGCAKKGKPGVYTKVCNYVNWI
KRTIADN
Download sequence
Identical sequences F6WME4
13616.ENSMODP00000000811 ENSMODP00000000811 ENSMODP00000000811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]