SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000836 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000836
Domain Number 1 Region: 19-112
Classification Level Classification E-value
Superfamily Immunoglobulin 6e-22
Family V set domains (antibody variable domain-like) 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000836   Gene: ENSMODG00000000697   Transcript: ENSMODT00000000854
Sequence length 113
Comment pep:novel chromosome:BROADO5:8:205174564:205175172:1 gene:ENSMODG00000000697 transcript:ENSMODT00000000854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKMLILLLLLGPSLGLGALISQQPSRVIWKKGSSVLIHCHQIDTQLTFMYWYHQLPQQSL
VLIATANQGSTATYEKGFDEAKFPISRPDTKSSTLTVTDLGPKDSGIYFCSAS
Download sequence
Identical sequences F6WLT1
13616.ENSMODP00000000836 ENSMODP00000000836 ENSMODP00000000836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]