SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000893 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000893
Domain Number 1 Region: 237-322
Classification Level Classification E-value
Superfamily Fibronectin type III 9.65e-24
Family Fibronectin type III 0.00033
Further Details:      
 
Domain Number 2 Region: 130-236
Classification Level Classification E-value
Superfamily Fibronectin type III 8.58e-19
Family Fibronectin type III 0.0000898
Further Details:      
 
Domain Number 3 Region: 25-127
Classification Level Classification E-value
Superfamily Fibronectin type III 1.02e-18
Family Fibronectin type III 0.00027
Further Details:      
 
Domain Number 4 Region: 337-432
Classification Level Classification E-value
Superfamily Fibronectin type III 2.71e-16
Family Fibronectin type III 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000893   Gene: ENSMODG00000000744   Transcript: ENSMODT00000000911
Sequence length 887
Comment pep:novel chromosome:BROADO5:8:91637386:91675576:1 gene:ENSMODG00000000744 transcript:ENSMODT00000000911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERTRRWLLCILFAVSWPSTKGDIEENIPHQTLSCHNDFQTRIICHWEEMANAQRYLNLS
LYYQMFKTVEAKQAPCDHSQNTSLPTCKFESCIPKTCFIHQKYMVGSQIDLFSFRTDRPL
EIKLNVSLGQSVQPPTPKNLQITKNGTKGFLLSWEILQSWNQNHQASSGVLMFEVAYKRQ
WESWEEAFTKSSSTSHVTFGHDHLIPDNRYVARVRAKTSGERSSPWSSEVSWESQEGDPA
QPKNLQCFFDGLEQLTCTWEVRAEVTGSVSFGLIYKAGPDETRECTPVHKERKPGSPYVQ
YRCQILVQDPNDQRQYTVTVQVKEEKKQIRSYLHVQPQPPYITVKKTGDSYWLNWKTVHT
IYEQIYEVQYRKSTESWEDVHNETLRIVLGMEISEKNLEPATDYFARVRAKISSESYRGI
WSEWSNEYKWTTDSRSGLQVPGPWILSLVLVVTTVLVLLGAWCCCNFGVRLKANWENKIP
NPSKSHLFQNKNKRIWIPGNFSTSSQESPWEKEERESCVSWSNWNDLEDTSRSWISPLTA
MDPQDACSLSSDQDSYPASINFPDENLSLFSSQKKHELNSPTKDLASGIAFNGPYLHLPH
SHSLPNITDQMGSCQAEENKKQPHGSLEYFCLPQGGQGGLIPMAKPAELGKDREEISSVV
PSDKEEPESYPFKDQAAPPSVEPRQEEHLNQPSTSSKDPLKLVHVTGYIAPEDLILGSGK
PESPPPLSMPPLPCSALESSVSPSIEKTKGPTSAPSSANLALESYVEVPPKMTSTEVLPE
DPSSLQVEPSTTNLMDSQQDETITMLHPDGLIVLQQIGDYCFFPSQGQLVSPGHCPEKMT
KPQDIQGKEPPNQPMPQVPAIQLFKAMKHQDYLALPTWDGCRPGQVF
Download sequence
Identical sequences F6VPW1
XP_007503493.1.35504 ENSMODP00000000893 ENSMODP00000000893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]