SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001006 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001006
Domain Number 1 Region: 12-241
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.09e-91
Family Eukaryotic proteases 0.000000261
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001006   Gene: ENSMODG00000000887   Transcript: ENSMODT00000001025
Sequence length 243
Comment pep:novel chromosome:BROADO5:8:205287620:205291294:1 gene:ENSMODG00000000887 transcript:ENSMODT00000001025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPLLILAFVGAAVAFSTDDDDKIVGGYTCEENGVPYQVSLNAGYHFCGGSLINEQWVVS
AAHCYKSRIQVRLGEHNIEVNEGNEQFIDAEKIIRHPKYSSWTLDNDIMLIKLKTPALLS
SRVTAISLPKSCAPAGTDCLISGWGNTGYDYPDLLQCLNAPILSDAQCRSSYPGQITENM
MCAGFLEGGKDSCQGDSGGPVVCNGELQGVVSWGIGCAQKNYPGVYTRVCKYVDWIESTI
AAN
Download sequence
Identical sequences F7BIT1
13616.ENSMODP00000001006 XP_001362395.1.35504 ENSMODP00000001006 ENSMODP00000001006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]