SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001008 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001008
Domain Number 1 Region: 19-243
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.78e-91
Family Eukaryotic proteases 0.00000033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001008   Gene: ENSMODG00000000845   Transcript: ENSMODT00000001027
Sequence length 246
Comment pep:novel chromosome:BROADO5:8:205406528:205411795:-1 gene:ENSMODG00000000845 transcript:ENSMODT00000001027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFLLILAFIGAAVAFFDDDDKIVGGETCQEASVPYQVSLNAGYHFCGGSLINEQWVVSA
AHCYMSRIQVRLGEHNIEVTEGNEQFIDSEKVIRHPGYSFWTLDNDIMLIKLKTPVILND
HVLPISLPKDCAPAGTECLISGWGNTLSSGADYPDLLQCLQAPLLSDAECRASYPGEITD
NMVCAGFLEGGKDSCQGDSGGPVACNGELQGIVSWGYGCAQKGRPGVYTKVCNFVNWIEE
TIAANS
Download sequence
Identical sequences F7BIQ2
XP_001362475.1.35504 ENSMODP00000001008 ENSMODP00000001008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]