SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001009 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001009
Domain Number 1 Region: 28-148
Classification Level Classification E-value
Superfamily Immunoglobulin 3.24e-25
Family C1 set domains (antibody constant domain-like) 0.0000179
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000001009
Domain Number - Region: 6-35
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00604
Family V set domains (antibody variable domain-like) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001009   Gene: ENSMODG00000000847   Transcript: ENSMODT00000001028
Sequence length 202
Comment pep:novel chromosome:BROADO5:8:205327497:205335587:1 gene:ENSMODG00000000847 transcript:ENSMODT00000001028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSSTPCITVTNTELYFGKGTRLIVLDDLERVTPPKVTVFQPSEEEIGEKGKATLVCLATG
FYPDLVELSWWVNGQETKIGVSTDPEPSKEHPKEEHSSYSLSSRLRISAPFWRNPKNNFR
CQVQFYGIAENETWSSNRSKPVTQNVSDQIWGKADCGVTFESYQQSIQSATFLYEILLGK
AMLYGLLVSALVWRAMIKKKYS
Download sequence
Identical sequences F7BIP4
ENSMODP00000001009 ENSMODP00000001009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]