SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001019 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001019
Domain Number 1 Region: 11-132
Classification Level Classification E-value
Superfamily Immunoglobulin 4.55e-25
Family C1 set domains (antibody constant domain-like) 0.0000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001019   Gene: ENSMODG00000000860   Transcript: ENSMODT00000001039
Sequence length 185
Comment pep:novel chromosome:BROADO5:8:205328349:205361196:1 gene:ENSMODG00000000860 transcript:ENSMODT00000001039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTQLVIVDDLERVTPPKVTVFQPSEEEIGEKGKATLVCLATGFYPDLVELSWWVNGQET
KIGVSTDPEPSKEHPKEEHSSYSLSSRLRISAPFWRNPKNNFRCQVQFYGIAENETWSSN
RSKPVTQNVSDQIWGKADCGITSESYQHSIQSATFLYEILLGKAVLYGLLVSALVWITMA
KKKNS
Download sequence
Identical sequences F7BI68
ENSMODP00000001019 ENSMODP00000001019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]