SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001038 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001038
Domain Number 1 Region: 11-103
Classification Level Classification E-value
Superfamily Immunoglobulin 1.29e-18
Family V set domains (antibody variable domain-like) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001038   Gene: ENSMODG00000000869   Transcript: ENSMODT00000001058
Sequence length 103
Comment pep:novel chromosome:BROADO5:8:205384411:205384867:-1 gene:ENSMODG00000000869 transcript:ENSMODT00000001058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCLCSISAGVGAQKIHQWPATKLQVAGSQLFLECFTEGTSSPNLYWYHQPPGGVLQLLSY
SMSQNHVENEMPQRFLGSRPQDGHFQLSSPKLLVTDSGFYFCA
Download sequence
Identical sequences F7AVL1
ENSMODP00000001038 ENSMODP00000001038 13616.ENSMODP00000001038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]