SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001041 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001041
Domain Number 1 Region: 124-220
Classification Level Classification E-value
Superfamily Fibronectin type III 1.25e-22
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 2 Region: 222-316
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000341
Family Fibronectin type III 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000001041
Domain Number - Region: 33-100
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0366
Family I set domains 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001041   Gene: ENSMODG00000000877   Transcript: ENSMODT00000001061
Sequence length 617
Comment pep:novel chromosome:BROADO5:2:24170870:24241707:-1 gene:ENSMODG00000000877 transcript:ENSMODT00000001061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKALSQWEVVIAFCLFFNWTYGDLTKVTCSGWVWVEPAPVFEMGLSVSIICQSNLRHCQ
PREFHLYKTSKHAQDRFHMEKINRTTAQLRLSNFQEPKAHVFCTVACARQDGETLICGKD
IASGYPPAVPANLTCFIAEHSGNMTCTWDAGSPTYVDTHYSVHVRSLQTGEEQLYLTSKY
ISISTNTLQSGRLYSIWVQASNALGTEESDHLQVNLDEIVIPALPVITRAEDLRTSVPTT
IIHWQSLTLMAGVSCEMRHKAATSPAWKVKELEINLSSIQYTALEPGTKYEFQARCRQMG
KGHGQAWSEPFFHTTPAAVAQVSWKPLQDPPRRIVPLNASIFKDRLISGNRNPSAGLLAG
MVLGIMVLSALFLTVIFKQSLRVRIKGRLLLLLPSWLHEDIPNVRNSCALKTLQETDEFM
TRHSGASLLAPDPVITELEEASPHGAGSRAELAALRDPGESAPLGDLTVPYLPAPGTGYR
PQMSHALPSGSPPGATRDPGLSALECQGASLGLGKNVVIRACPSPVFPGSGTRAGRDFLS
LEEIGLVLDSSERGPVGGPEEADLEAGMLLEKQPSRESRPEQSLLPAAPASCVRLTGDEE
APDVRSYFPQRFGRPFP
Download sequence
Identical sequences F7AV62
XP_007480480.1.35504 ENSMODP00000001041 ENSMODP00000001041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]