SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001083 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001083
Domain Number 1 Region: 119-461
Classification Level Classification E-value
Superfamily L domain-like 6.12e-62
Family Internalin LRR domain 0.024
Further Details:      
 
Domain Number 2 Region: 689-784
Classification Level Classification E-value
Superfamily Immunoglobulin 2.4e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 3 Region: 602-698
Classification Level Classification E-value
Superfamily Immunoglobulin 1.54e-20
Family I set domains 0.0074
Further Details:      
 
Domain Number 4 Region: 497-606
Classification Level Classification E-value
Superfamily Immunoglobulin 2.31e-17
Family I set domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001083   Gene: ENSMODG00000000908   Transcript: ENSMODT00000001104
Sequence length 1063
Comment pep:novel chromosome:BROADO5:2:483609194:483649489:1 gene:ENSMODG00000000908 transcript:ENSMODT00000001104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASLQPSPWKLLVAVLASGPLLRLLLLFQTVLLLLPAAATRAGLCPVPCSCSFPLLDCS
WRKPDWRALSGPLPPGTTSLDLSHNRLSNWSISLDSKVLQEVKMNYNQLTEIPYFGEPTS
NITLLSLVHNVIPEVNAEQLLFYLSLETLDLSSNQISEIKTSSFPRMQLKYLNLSNNRIA
TLEAGCFDNLSSSLIVVKLNRNRISMIPPKIFKLPHLQFLELKRNRIKTVESLTFQGLDS
LKSLKMQRNGISRLMDGAFFGLVNMEELELEHNNLIEVNKGWLYGLRTLQQLYVSQNAID
RISPDAWEFCQQLSELDLSYNQLTRLDESAFVGLSLLEKLNLGDNRVTHIADGVFKDLSN
LQTLDLRNNEISWAIEDASEAFVGLTKLTKLILQGNHIKSVTKKAFIGLEALEHLDLNNN
AIMSIQENAFAQTHLKELMLNTSSLLCDCQLRWLMQWLVDSHLEQAVNVSCAHPEWLAGQ
SILNVDPKDLVCDDFPKPQIRTHPETTIALKGVNVTLTCTAVSSSDSPMSTAWRKDSEIL
YDADIENFARYRQQGGEALEYTTVLHLFNVNFTDEGKYQCIVTNHFGSNYSHKARLIVNE
LPSFLKTPMDLTIRTGAMARLECAAEGHPAPQISWQKDGGTDFPAARERRMHVMPEDDVF
FIANVKIEDMGIYSCMAQNIAGGLSANATLTVLETPSFIRPLEDRTVTRGETAVLQCIAG
GSPAPRLNWTKDDGPLMVTERHFFAAANQLLIIVDTGLDDAGKYTCIMSNTLGTERGHIY
LNVISSSNCDSSQNSIGHEDDGWTTVGIVIIVVVCCVVGTSLIWVIVIYHMRRKNEDYSI
TNTEELNLPADIPSYLSSQGTLSEPQEGYSNSEAGSHQQLMPPANGYIHKGPEGGSGSRV
ICSDCYDNANIYSRTREYCPYTYITEEDGLDQTLSSLMVQVPKEPCLSHPSPETAALDPL
ISSGDMSVFLTNHDRINEKALSSTQMSSETSQRPLWGINKELGLPPPHFSQQPVLESPQL
LRNESLTENDEDHTTSPRPCQRLPGRPCDFSRTQNGQDGSEAT
Download sequence
Identical sequences F6ZHI5
ENSMODP00000001083 XP_007485221.1.35504 ENSMODP00000001083 13616.ENSMODP00000001083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]