SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001115 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001115
Domain Number 1 Region: 118-204
Classification Level Classification E-value
Superfamily Immunoglobulin 2.79e-16
Family I set domains 0.00026
Further Details:      
 
Domain Number 2 Region: 204-286
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000254
Family I set domains 0.00034
Further Details:      
 
Domain Number 3 Region: 34-116
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000127
Family I set domains 0.00048
Further Details:      
 
Domain Number 4 Region: 288-372
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000103
Family I set domains 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001115   Gene: ENSMODG00000000936   Transcript: ENSMODT00000001137
Sequence length 450
Comment pep:novel chromosome:BROADO5:2:52307200:52352775:1 gene:ENSMODG00000000936 transcript:ENSMODT00000001137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGESWVPQPVTTFSSVLLWAGLLCLAPAVKSNGPPKALLTLEPPWVNVLREDNVTLKCEG
LQTPGHDSTEWFHNGSPISINQESYTIPALNLKDSGEYQCRTEQTSLSNPVRLQVTSDWL
LLQVESLVFMEGDSTMLRCHSWKSKPLYKVTYYHNDKALKYGYHYFDYIIPQVNLTHSGS
YYCAGQMGRVLHTSKSVMITVQGPPKALLTLEPPWVNVLREDNVTLKCEGFQTPGHDSIE
WFHNGSAISFHQESYTIPAVNLKDSGEYQCRTEQTSLSNPVQLQVTSDWLLLQVESLVFM
EGDSTMLRCHSWKNKLLHKVTYYHNDKALKYAYECFDYIVPQVNYTHSGSYYCAGQMGHV
IHISKSVMITVQGGKSSVMKGLIIALILVVVIAVIVAAALYYYKRHKRTASVPDEIGSTV
VESSVSYSLLKHTDAPEEEESGRGGYQNYQ
Download sequence
Identical sequences F7F7Z5
ENSMODP00000001115 ENSMODP00000001115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]