SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001128 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001128
Domain Number 1 Region: 101-190
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000626
Family I set domains 0.001
Further Details:      
 
Domain Number 2 Region: 20-97
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000102
Family I set domains 0.0043
Further Details:      
 
Domain Number 3 Region: 193-282
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000177
Family I set domains 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001128   Gene: ENSMODG00000000945   Transcript: ENSMODT00000001151
Sequence length 421
Comment pep:novel chromosome:BROADO5:2:52396212:52400503:1 gene:ENSMODG00000000945 transcript:ENSMODT00000001151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFKLLDFDFLLKTSSIATMEKPILSLHPPWTTIFKGERVILRCDGYQPLLLEPRPINTLW
YLGHQLLPSHKKTIEVQTPGIYRCQTRGAPVSDPIHLSMSNDWLILQVPYAMVFEGEPLV
IRCRGWYDKVIYKLHYYKDGHVMRYFHSSANYTIPQARASDSGQYQCSGTLRIPVESTPM
FSAKVVVTIQELFASPVLKVVPKPDSRSGGGVTLHCETRLHPQKRDTPLQFSFYKYSRPV
RRFDWGSEYTVPETETEDLESYWCESATVTRSVRKRSPWLQLAGRGDTSSITTRAPQPAA
MSRNPVSKPLSFRKPPEPRLVPSGTSTPNSTLTRALASVPSIPTAGPTACSPLTSLEQSA
SPSKPNMDLLLQEMQQLKSLLRQVMLELKEPHKVLGLKGIPKTPALDVGVSLVTPQITGR
D
Download sequence
Identical sequences F7F7V1
13616.ENSMODP00000001128 ENSMODP00000001128 ENSMODP00000001128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]