SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001174 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001174
Domain Number 1 Region: 645-920
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.56e-61
Family Protein kinases, catalytic subunit 0.0000000548
Further Details:      
 
Domain Number 2 Region: 32-213
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.53e-55
Family Ephrin receptor ligand binding domain 0.00000435
Further Details:      
 
Domain Number 3 Region: 349-558
Classification Level Classification E-value
Superfamily Fibronectin type III 7.83e-30
Family Fibronectin type III 0.0000969
Further Details:      
 
Domain Number 4 Region: 931-1004
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000209
Family SAM (sterile alpha motif) domain 0.00093
Further Details:      
 
Domain Number 5 Region: 277-342,388-405
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000011
Family Growth factor receptor domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001174   Gene: ENSMODG00000000983   Transcript: ENSMODT00000001198
Sequence length 1006
Comment pep:novel chromosome:BROADO5:8:205485989:205500367:1 gene:ENSMODG00000000983 transcript:ENSMODT00000001198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLIKGATQPGDKVEDMVWIWALLFIIPALALEEVLLDTTGETSEIGWLTYPPGGWDEVSV
LDNQQRLTRTFEACHVAEGLGLGQDNWLQTHFVDRQGAHRAHIRLHFSVRACTSLGVGGG
MCRETFTLYYRQAEEPDDPSHASAWHLGPWIKVDTIAADESFPASASSSSWSGGAGLQLN
VKERSFGPLTQRGFYVAFQDTGACLALVVVKIFAYSCPAVLQAFASFPETQASGAGGASL
VEAVGTCVAQAEPEDDGVGSNLPRLHCNGEGEWMVAVGSCHCRPGYQPAHGDRACQACPR
GSFKALAGGASCIPCPSRSHSAMPGASMCPCLSGFYRSSSDAPEAPCTGPPSAPRDLWFE
VQGSSLMLYWRLPQDLGGRGDVRFNIVCKQCGEEHSPESGACHHCGDEVYFDPRQQGLTE
SRVLVGGLRAHVPYILEVQSLNGVSEFSFEPPKTAAINVSIIHEVPPAVPLLHQVSRASD
SITVSWSQPDQRHGRVLDYQLRYYDQADEAHFSILTSETNTATVSQLSPGHIYGFQVRAR
SAAGHGPYGGKVYFQTLPQGELSRLIPERLPLVVGSALGALAFLVLAVITIFAFIFQRKR
QRTGYTEPLQQYASPSGLGVKYYIDPSTYEDPSQAIREFTREVDPAYVKIEEVIGPGSFG
EVCRGWLQPRGRREQAVAIRTLWASGVESQRDAFLGRAAVLGQFHHPNVLRLEGVVTKSQ
PLMVLTELMENGPLDSFLRQQEGQFSNLQLVAMQRGVAAAMQYLSSCGFVHRALTAHSVL
VNGHLVCKVAHLSHGHSYLSHNSQGLQPPLRWSAPEVLTHGKFTTASDIWSFGILMWEVM
SYGERPYWDMSDQEVVHAIEQEFRLPPPPGCPNGLHLLMLDTWQQDSAQRPHFDQLVAAL
DKMIRKPEMLQAGGVHRGRQSQSLLSPVTLDFSSLETPQAWLTAIGMECYQDSFSKVGLC
SFNEVAQLSLEDMPALGITLAGHQKKLLHNIHLLQQHLSQPGPVEV
Download sequence
Identical sequences F7ES42
XP_007504530.1.35504 XP_016281684.1.35504 ENSMODP00000001174 ENSMODP00000001174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]