SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001235 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001235
Domain Number 1 Region: 72-175,261-356
Classification Level Classification E-value
Superfamily Fibronectin type III 1.02e-32
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 2 Region: 383-475
Classification Level Classification E-value
Superfamily Immunoglobulin 1.48e-22
Family I set domains 0.0048
Further Details:      
 
Domain Number 3 Region: 172-274
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000033
Family I set domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001235   Gene: ENSMODG00000001040   Transcript: ENSMODT00000001260
Sequence length 480
Comment pep:novel chromosome:BROADO5:2:107433153:107451140:-1 gene:ENSMODG00000001040 transcript:ENSMODT00000001260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGEAEAETSALTPEEKTSDPANGPIPEANGTEAIPEPAGGETATAVPPEPASEELSPAA
PAASLPLPPSEDLPSCPLLLTVEDVTDSSVALSWEPPENLGRLGIQGYILEYCQQGASEW
VPVNARPMMVTQHTLRNLTTGSKLFFRVSAVSSAGTGPATVLDQPVHIKEIIEAPKIRVP
RYLRQTYIRQVGETINLQIPFQSTPKPQVTWTHNSHALDTKRVSVRNGEQDSILFIRSAQ
RVDSGRYELSIRLEGLEAKATIDILVIERPGPPKSIKLLDVWGFNAALEWTPPEDTGNTE
LLGYTVQKADRKTGQWFTVLEHCHRTNCTVSDLIIGNSYSFRVFSENQCGLSATAPVTAE
LAHIQKADTVSKRDGIRERDFSEAPKFTHPLADHTTTPGYSTQLFCSVRATPKPKIIWMK
NKMDIQGNPKYRALSEQGVCSLEIRKPSLFDAGVYTCKAINALGEASVDCRLDVKASATH
Download sequence
Identical sequences F6ZEY0
XP_007481239.1.35504 ENSMODP00000001235 ENSMODP00000001235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]