SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001779 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001779
Domain Number 1 Region: 627-922
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.05e-77
Family Protein kinases, catalytic subunit 0.0000000559
Further Details:      
 
Domain Number 2 Region: 27-202
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.36e-55
Family Ephrin receptor ligand binding domain 0.0000154
Further Details:      
 
Domain Number 3 Region: 335-540
Classification Level Classification E-value
Superfamily Fibronectin type III 1.06e-25
Family Fibronectin type III 0.0036
Further Details:      
 
Domain Number 4 Region: 912-979
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.69e-19
Family SAM (sterile alpha motif) domain 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000001779
Domain Number - Region: 259-328,370-389
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00102
Family Growth factor receptor domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001779   Gene: ENSMODG00000001465   Transcript: ENSMODT00000001817
Sequence length 980
Comment pep:novel chromosome:BROADO5:8:206474621:206494370:-1 gene:ENSMODG00000001465 transcript:ENSMODT00000001817 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRRCPLGLGLLLLLCAQLPPGAPAKEVTLLDTSTAQGELGWLLDPPETGWSEVQQMLNG
TPMYMYQDCPMLAGGDTEHWLRSNWIYRGEAASRVHVELQFTVRDCKSFPGGSGPQGCKE
TFNLFYMESDHDVGIQLRRPLFQKVTTVAADQSFTIRDLATGAVRLNVERCLLGHLTRRG
LYLAFHNPGACVALVAVRVFYQRCAEIVHKLAHFPDTLPKSMGLVEVAGTCLPHAQYAPG
PSVAPRMHCSTDGEWLVPVGRCYCNPGYQEVKEENGVEQCAACPVNFYRSEMDTPSCLKC
PPHSTAKSVGATICTCVSGHYRTPGEGPQVACTRPPSAPQNISFSLSGTQLSLQWKPPKD
SGGRRDVIYNVECAQCQGIAPDEGLCQPCGAAVHFSPGTKGLTLPALQINGLEPYANYTF
RVEAKNGVSDLDPSGSPSAMLSLSIGHAEPLSGLSLSLVKRGPRRLELSWAGSQPRSPGV
NLSYELHVLNQKEERYQMVPEPRALLTELQPDTTYVVRVRTLTPLGPGPYSPDHEFRTSP
PLFKGLSGGEIVAVVFGLMLALALILGFFIFRKRRRTQKQKRQRECPSDGGDREDKLWLK
PYVDLQAYEDPAQGALDFARELDPTWLTVDTVIGEGEFGEVYRGILRIPSHDCFTVAIKT
LKASSPDGHWWNFLREATIMSQFNHQHILHLEGVITKRKPIMIITEFMENGALDAFLRAQ
EEQLAPGQLVSMLQGIASGMSHLSDHRYVHRDLAARNILVSQDLCCKVSDFGLTRLLDND
RDGTYETQGGKIPIRWTAPEAIAHRVFTSASDVWSFGVVMWEVLSFGDKPYGDMSNQEVM
KSIEDGYRLPPPVDCPAPLYDLMKCCWAYDRTCRPRFRQLQTQLEQLLDSPHTLRTIANF
DPRVTLRLPSVSGSDGIPYRSVSEWLESIRMKRYILHFRSAGLDTMECVLELTTEDLKQM
GITQAGHQKRILCSIQGFKD
Download sequence
Identical sequences F7APP4
ENSMODP00000001779 ENSMODP00000001779 XP_001362907.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]