SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002034 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002034
Domain Number 1 Region: 932-1121
Classification Level Classification E-value
Superfamily Fibronectin type III 2.5e-31
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 2 Region: 730-928
Classification Level Classification E-value
Superfamily Fibronectin type III 1.87e-30
Family Fibronectin type III 0.0000444
Further Details:      
 
Domain Number 3 Region: 358-447
Classification Level Classification E-value
Superfamily Immunoglobulin 2.47e-20
Family I set domains 0.014
Further Details:      
 
Domain Number 4 Region: 619-714
Classification Level Classification E-value
Superfamily Immunoglobulin 2.75e-18
Family I set domains 0.014
Further Details:      
 
Domain Number 5 Region: 532-627
Classification Level Classification E-value
Superfamily Immunoglobulin 2.73e-17
Family I set domains 0.011
Further Details:      
 
Domain Number 6 Region: 437-534
Classification Level Classification E-value
Superfamily Immunoglobulin 1.07e-16
Family I set domains 0.009
Further Details:      
 
Domain Number 7 Region: 143-244
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000513
Family I set domains 0.0098
Further Details:      
 
Domain Number 8 Region: 250-326
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000199
Family I set domains 0.017
Further Details:      
 
Domain Number 9 Region: 1225-1302
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000365
Family Fibronectin type III 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002034   Gene: ENSMODG00000001662   Transcript: ENSMODT00000002077
Sequence length 1446
Comment pep:novel chromosome:BROADO5:2:110585428:110788610:1 gene:ENSMODG00000001662 transcript:ENSMODT00000002077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKKILEHATCRKVSSNSQKSGTQERESRKKQTNPQKKSLDLCAVWESGVFHPSAGQDSA
SKTASKRRVNETKKLSSLQAVQLERQQEAVRPRGTGSWDQGPAPRMAVGPLLWIHVAFIL
WLCSFVGAIEVPLDPNIQNELSQPPTITKQSVKNYIVDPRDNILIECEAKGNPTPSFQWT
RNSRFFNVAKDPRVSMLRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIFLQV
SKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSMEPINQDKRVSQGQNGD
LYFSNVMLQDAKTDYSCNARFHFTHTIQQKNPFILKVLTTRGVAERTPSFMYPLGTSSSQ
MVLRGMDLLLECIASGVPAPDIAWYKKGGDLPAGKVKFENFNKALRITNVSEEDSGEYFC
LASNRMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRANGNPKPTVQWLVNGDP
LEAAPPNPSREVAGDTIIFRDTQIGSSAVYQCNASNDHGYLLANAFVSVLDVPPRMLSPR
NQLIKVIHYNRTRLDCPFFGSPIPTLRWFKNGQGSNLDGGNYQVHENGSLEMAMARKEDQ
GIYTCVATNILGKAENQVRLEVKDPTRITRVPEDQVVKRGTNVVLECRVKHDPTLKLTVN
WLKDDEPLYIGNRMKKEEDSLTIFGVADRDQGSYTCMASTELDRDIAKAYLTVLAAQVVP
TNRMAPLPKERPDPPRDLELTDLEERSVRLTWIPGDDNNSPITEYIIQFEEDQFQPGVWH
SHSKHPGSVNSAVLQLSPYVNYQFRVIAVNDVGSSHPSLPSERYRTSGAPPESNPGDVKG
AGSRKNNMEITWTPMNATSAFGPNLRYIVKWRRREGRESWNNATVWGSRYTVVQTPVYVP
YEIRVQAENDFGKGPEPDTVIGYSGEDYPRAAPTDVKVRVLNSTAIGLQWNRVYPDTVQG
QLREYRAYYWRDSSLLKGLWVSQKRQFASFSSDRIRGVVSSLFPYSNYKLEMVVVNGRGD
GPRSEVKEFTTPEGVPSAPRRFRVRQPNLETINLEWDHPEHPNGILTGYNLKYLAFNGTK
TGKALIETFSPNQTKFSIQRADPVSRYRFSLSARTQVGSGEVVTEESPAPPNEATPTPAP
TMLPPTTVSATSAASSTDVTAVATTAAATTLPTAAPTTTTTTTVATTASTTTTAATTTTE
SPPTAVTKIQDTAPYGQSIWNFTVKANSKSANLTWDHNLEPGTEFVIEYSYSNQSTKIHS
IKTQYYSLKELNPGIFYSFRVYSQNRPAITSSLVTVQTTDDSAFTRNQVDIATQGWFIGL
MCAIALLVLILLIVCFIKRSGRGKYQVREKKDVPLDPEDQKEEDGSFDYSDEDNKPLQGS
QTSLDGTIKQQESDDSLVDYGEGGEGQFNEDGSFIGQYTVKKDKEETEGNESSEATSPVN
AIYSLA
Download sequence
Identical sequences F6SRB0
ENSMODP00000002034 ENSMODP00000002034 XP_007481292.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]