SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002070 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002070
Domain Number 1 Region: 601-807
Classification Level Classification E-value
Superfamily Fibronectin type III 3.25e-33
Family Fibronectin type III 0.0005
Further Details:      
 
Domain Number 2 Region: 810-997
Classification Level Classification E-value
Superfamily Fibronectin type III 8.98e-26
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 3 Region: 316-408
Classification Level Classification E-value
Superfamily Immunoglobulin 2.23e-19
Family I set domains 0.0000301
Further Details:      
 
Domain Number 4 Region: 505-607
Classification Level Classification E-value
Superfamily Immunoglobulin 2.1e-18
Family I set domains 0.022
Further Details:      
 
Domain Number 5 Region: 425-508
Classification Level Classification E-value
Superfamily Immunoglobulin 4.54e-18
Family I set domains 0.011
Further Details:      
 
Domain Number 6 Region: 241-324
Classification Level Classification E-value
Superfamily Immunoglobulin 1.54e-17
Family I set domains 0.00014
Further Details:      
 
Domain Number 7 Region: 31-120
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000186
Family I set domains 0.0000565
Further Details:      
 
Domain Number 8 Region: 133-218
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000258
Family I set domains 0.0000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002070   Gene: ENSMODG00000001692   Transcript: ENSMODT00000002113
Sequence length 1036
Comment pep:novel chromosome:BROADO5:2:110841099:110879302:1 gene:ENSMODG00000001692 transcript:ENSMODT00000002113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGIPEQLLMASLAVLSFSAWNPAQGSPTIFGPIFEDQPVSSLFPEESSEEKIALACRARA
SPPATYRWKMNGTEMKLEQDPHYQLVGGNLVIMNPTKAKDAGVYQCLASNPVGTVVSREA
VLRFGFLQEFSKEERDPVKTHEGWGVMLPCNPPAHYPGLSYRWLLNEFPNFIPTDGRHFV
SQTTGNLYIARTNASDLGNYSCLATSHMDFITKSVFSKFAQLNLAAEDSRPSPPSIKARF
PLETYALVGQQVTLECFAFGNPVPRIKWRKMDDSLPPQWATAEPTLQIPSISFEDEGTYE
CEAENIKGRDIAKGRIIVQAKPEWLKVISDSEADIGSNLHWGCAAAGKPRPIVRWLRNGD
PLLSQNRVEISGGDLKFSKLVLEDSGMYQCVAENKHGTIYASAELAVQAFAPDFRLNPVK
RLIPAARGGEVIIPCQPRSAPKSIVLWSKGTEILVNSSRVTITPDGTLILRNISRSDEGK
YTCFAENFMGKANSTGILSVRDATKITLAPSSADINLGENLTLQCHASHDPTMDLTFTWS
LDGFPIDFDKSGGHYRRANLKETIGDLTILNAQLRHGGKYTCMAQTVVDSTSETATLLVR
GPPGPPGGVVVRDISNTTVQLTWSRGFDNHSPIAKYILQARSLPDGKWKQVRTNPANIEG
NAETAQVLGLTPWMDYEFRVLASNILGTGEPSGPSSKIRTKESAPTIAPSGLSGGGGAPG
ELIINWKPMLREYQNGEGFGYILSFRRQGSSDWQRAKVSQADALHFVYRNESVRPYTPFE
VKIRGYNRQGEGPESLTTLVYSAEEEPRVAPAKVKAKGTLSSEMNVMWEPVHQDDMNGIL
LGYEIRYWKDGDKEAAADRVRTAGLDTSAQVTGLQPNTKYHVTVRAYNRAGTGPASPSTN
ATTMKPPPNRPPGNISWTLASSSLIIKWDPVIPQRNESAVTGYKMLYRNDLHSVPTLHLS
NKNWIEISVPEDSSHALVQIRATGPGGDGIPAEVHIVRNGGTSMMVENSAVCLTPHLGTI
LSHSLAMLALLGYLEL
Download sequence
Identical sequences F6S7H2
XP_007481309.1.35504 XP_016285586.1.35504 XP_016285587.1.35504 ENSMODP00000002070 ENSMODP00000002070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]