SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002105 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002105
Domain Number 1 Region: 39-254
Classification Level Classification E-value
Superfamily L domain-like 1.16e-31
Family Ngr ectodomain-like 0.0033
Further Details:      
 
Domain Number 2 Region: 246-346
Classification Level Classification E-value
Superfamily Immunoglobulin 1.12e-17
Family I set domains 0.011
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000002105
Domain Number - Region: 371-434
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0017
Family Fibronectin type III 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002105   Gene: ENSMODG00000001718   Transcript: ENSMODT00000002148
Sequence length 548
Comment pep:novel chromosome:BROADO5:1:65447060:65452663:-1 gene:ENSMODG00000001718 transcript:ENSMODT00000002148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPICHFFFLVLVFLEANPTYPACNPECICSDASFGRSLLCMDTSLTKILGNIPEDTKKL
RIENSHLTELPYGSFPNNSALEFLWLNFNNITVIHPGALEHLRDLKELRLQGNMLCTVPW
TAFQATPVLNILDLKHNRLDVLPKQALQYLINLTYLDLSFNELTVVSVDVFIQWPMYQRS
QQHISGAEGISNVVLALHNNPWMCDCHLKGLVQFFKFIRPPVILMNSYLMCQSPLSKAGQ
FFYEVELTSCMKPKTSTPNSNITVQVGLNITLSCLVQASPLPNIIWTYPLKKLREFDVST
SPTGEDSIQSELVIPSAHLTDSGNYSCVATNSMGSSSIPISLRVQPRQAVPSSSSSLASL
EEHSYIYMSITKQTVYGIGLEWYAVTDNPSETWFTLYFGIYEAIKKEMISIGPGINTYWV
NDLLPATKYEACISLQSQPPRKDQCIVFVTGNDISELEKREKIIHIIVVVCALVLAVPVG
TYVCTSEAHFGCLGHCLNCCPQWRNGSRCRGTVIESRNTMFNNLASGIEENLSLGDIRED
QRWKNGRE
Download sequence
Identical sequences F6XGD0
ENSMODP00000002105 13616.ENSMODP00000002105 ENSMODP00000002105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]